SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31101
         (810 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              26   0.36 
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    22   7.7  

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 26.2 bits (55), Expect = 0.36
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +2

Query: 632 DISSYGCIYVIITAIV*VDYVNIMCSRNTTLRRGHRLDPNILLIFITFILVRYSIRIM 805
           D+SSY C+ + +   V   +V I C    T    +R    +LL ++T  ++ Y  +I+
Sbjct: 690 DLSSYNCVPINVQFSVLYGFVIIECQEPVT----NRPTGQLLLDYLTDTVLAYKPKIL 743


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 21.8 bits (44), Expect = 7.7
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -1

Query: 600 RIASFCCPGRER 565
           RI   CCPGR R
Sbjct: 403 RILCACCPGRVR 414


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 208,443
Number of Sequences: 438
Number of extensions: 4333
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -