BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31100 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces p... 30 0.28 >SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 30.3 bits (65), Expect = 0.28 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = -2 Query: 447 NLLLISSLFNGCYYTYKPSYLITLSIKKKTHQNPLRSLKDLSIHRERYR-DRESDFVLYY 271 N++ + +G Y + L+++K+ N +L DL I R + D++S+FVLY Sbjct: 173 NIVHEEDVVHGSDYLTNVFIAVPLNLEKQ-FLNSYETLTDLVIPRSAKKLDQDSEFVLYT 231 Query: 270 VVIK*ISRNNYIYETR 223 VV+ + +++I + R Sbjct: 232 VVVFKKTADSFITKAR 247 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,583,886 Number of Sequences: 5004 Number of extensions: 50078 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -