BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31100 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 4.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 4.9 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.5 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 8.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.6 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 553 IYLNNACIIYKYNHYIILHYFIKYLRPAPASL 458 I+ NN YN+Y L+Y I Y+ P + Sbjct: 90 IHNNNNYNNNNYNNYKKLYYNINYIEQVPVPI 121 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 553 IYLNNACIIYKYNHYIILHYFIKY 482 ++L+ A I + ++HYF KY Sbjct: 280 VFLSFAFIFATIIQFAVVHYFTKY 303 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 24 NSISENNTVIDQRVNDVNVSVNTGYYKL 107 NS+S NN + N+ N + NT Y KL Sbjct: 86 NSLS-NNYNYNNNYNNYNNNYNTNYKKL 112 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 559 YKIYLNNACIIYKYNHYIILHYFIKYLRPAP 467 Y Y NN YN+Y L+Y I Y+ P Sbjct: 94 YNNYNNNN----NYNNYKKLYYNINYIEQIP 120 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 520 YNHYIILHYFIKYLRPAP 467 YN+Y L+Y I Y+ P Sbjct: 111 YNNYKKLYYNINYIEQIP 128 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 42 NTVIDQRVNDVNVS 83 NT+ID R ND++++ Sbjct: 426 NTIIDYRNNDLSIN 439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,071 Number of Sequences: 438 Number of extensions: 4031 Number of successful extensions: 19 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -