BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31097 (713 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 5.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.8 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 3.8 Identities = 15/71 (21%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = +2 Query: 275 IVEEDAEAMQKELREAFRLYDKEGNGYIPTSSLREIXXXXXXXXXXXXXXXX--IQEIDT 448 ++ +D + + + F YD+ NG + L + I DT Sbjct: 226 LMSQDNHSKEYLVSIMFSHYDRNNNGNLEREELEQFAENEDLEELCRGCNLGHMISYDDT 285 Query: 449 DGSGTVDFDEF 481 DG G ++ +EF Sbjct: 286 DGDGKLNVNEF 296 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 321 RSDCTTRKATVTFPRRACARSSGNWT 398 +S CT F ++ C G+WT Sbjct: 148 QSSCTIDVTYFPFDQQTCIMKFGSWT 173 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 699 TPDQLRTINYSLYNTYIILEKLADRY 622 +PD+ + Y LYN +I + + +Y Sbjct: 417 SPDRTSPMEYRLYNPALIQSQPSPQY 442 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 417 NSMASSKRSTLTEAAPSTSTS 479 NS ASS R A STSTS Sbjct: 821 NSPASSPRYLSAAATSSTSTS 841 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,533 Number of Sequences: 438 Number of extensions: 3299 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -