BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31096 (861 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 31 0.21 SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|... 27 2.6 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 31.1 bits (67), Expect = 0.21 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 634 RARTVLPTRSGPSSNALPPRNRSRFNVPGT 545 R + +LP RSG SS+ +P N + NVP T Sbjct: 1016 RVKPLLPPRSGSSSSGVPAPNLTPVNVPPT 1045 >SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 27.5 bits (58), Expect = 2.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 304 VKCIWRRKLSFRMLSSWYCRNLRRCRSSIC 393 VKCI LS +LS + RNL R S C Sbjct: 362 VKCICLTDLSVILLSGSFSRNLERVHLSYC 391 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,564,874 Number of Sequences: 5004 Number of extensions: 73509 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -