BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31093 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 32 0.017 DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 24 5.9 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 32.3 bits (70), Expect = 0.017 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 328 NIYFLKHKH---RYENYNVNLSYIPVRWYHPITVGHPMRIPLSKFQEKVGLADVILS*CL 498 ++ FL H + +++ +SYI W+ + V + L K E V L + I+ CL Sbjct: 61 SVKFLMHDRTVPKEDSFERKVSYIMTNWFLNVLVFITNDVALLKLSEPVPLGETIIPVCL 120 Query: 499 QPE 507 PE Sbjct: 121 PPE 123 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 23.8 bits (49), Expect = 5.9 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -2 Query: 268 YCNSWLRNVHTHMKC 224 +CN W+ H+KC Sbjct: 80 HCNEWIAGNECHLKC 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,554 Number of Sequences: 2352 Number of extensions: 13645 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -