BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31093 (767 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-2|AAU87810.1| 520|Caenorhabditis elegans Hypothetical ... 33 0.22 Z81483-6|CAE53731.1| 277|Caenorhabditis elegans Hypothetical pr... 28 8.4 >AC024817-2|AAU87810.1| 520|Caenorhabditis elegans Hypothetical protein Y54G2A.38 protein. Length = 520 Score = 33.1 bits (72), Expect = 0.22 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 6/94 (6%) Frame = -3 Query: 648 CLRLHFKQTYLLRVMIVVLLL------FSYFG*KQNHYYMLKENLSVIGGIDTFRLKTLR 487 C LHF Y M+ ++ L F YF ++ ++ ++ +I GI TF +T+ Sbjct: 323 CYFLHFGNAYFQYFMVTLMSLNRTTSIFFYFVNEKIWKFLFPFSIVLIIGITTFCARTI- 381 Query: 486 QYDICKSNFLLKLRQRDSHWVTNSNWMIPAYWNV 385 + S + L D +++ + + ++PAY+N+ Sbjct: 382 ---LATSPYYLYNEVLDMYYIKSDSNILPAYYNI 412 >Z81483-6|CAE53731.1| 277|Caenorhabditis elegans Hypothetical protein C43D7.9 protein. Length = 277 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +1 Query: 328 NIYFLKHKHRYENYNVNLSYIPVRWYHPITVGHPMRIPL 444 NI+ + +++ + +++L + WYHPI H +++ L Sbjct: 130 NIWLQRIVNQFSSGSLDLFFSKSTWYHPILSAHRLQLNL 168 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,217,743 Number of Sequences: 27780 Number of extensions: 324656 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -