BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31088 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 ... 31 0.72 At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 ... 31 0.72 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 0.95 At3g03480.1 68416.m00346 transferase family protein similar to h... 31 0.95 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 2.9 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 3.8 At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransfera... 28 5.0 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 5.0 At4g18030.1 68417.m02684 dehydration-responsive family protein s... 28 6.7 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 6.7 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 6.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 28 6.7 >At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 623 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 300 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 163 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 627 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 300 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 163 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 0.95 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 330 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 446 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At3g03480.1 68416.m00346 transferase family protein similar to hypersensitivity-related gene GB:CAA64636 [Nicotiana tabacum]; contains Pfam transferase family domain PF00248 Length = 454 Score = 30.7 bits (66), Expect = 0.95 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = -1 Query: 427 MPSRLMLPKGTYDGFPFQLF----VFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLP 260 M ++ LP+ T G F++ V P +PTP+E +P S + D + G F PV+ Sbjct: 1 MDHQVSLPQSTTTGLSFKVHRQQRELVTPAKPTPRELKPL-SDIDDQQ--GLRFQIPVI- 56 Query: 259 QYFKQPNM 236 +F +PN+ Sbjct: 57 -FFYRPNL 63 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 309 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 455 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 3.8 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 1/98 (1%) Frame = -1 Query: 457 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 278 P ++NS P P Y P +VY P P PF V + P Y + Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPPP---YVYNSPPPPPYYSPFPKVEYKSPPPPYIY 398 Query: 277 DRPVLPQYFK-QPNMFFKKVLVYHEGELFPYLFNIPHY 167 + P P Y+ P + +K PY++ P+Y Sbjct: 399 NSPPPPPYYSPSPKITYKSPPP-------PYIYKTPYY 429 >At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransferase, putative similar to Swiss-Prot:P05055 polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) (Polynucleotide phosphorylase) (PNPase) [Escherichia coli] Length = 991 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 285 IHSIAPFFLSTSNNLTCSSRRSWSTMKENYS 193 + S++P ST++NL S+ STMKEN S Sbjct: 877 LKSVSPKNNSTASNLVSFSKAKKSTMKENLS 907 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 364 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 227 +VY P P S P V + P Y + P P Y PN+++K Sbjct: 308 YVYSSPPPPYYS-PSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYK 352 >At4g18030.1 68417.m02684 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 621 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 361 VYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGE 200 +Y P ++E + +VP K + PF P Y N FK + V G+ Sbjct: 113 IYRERHCPPDNEKLRCLVPAPKGYMTPFPWPKSRDYVHYANAPFKSLTVEKAGQ 166 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 364 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 227 +VY P P S P VV + P Y + P P Y P +++K Sbjct: 567 YVYSSPPPPYYS-PSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYK 611 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 330 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 446 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.9 bits (59), Expect = 6.7 Identities = 22/77 (28%), Positives = 27/77 (35%) Frame = -1 Query: 457 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 278 P SS P PK TY P +VY P P P V + P Y + Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVY 766 Query: 277 DRPVLPQYFKQPNMFFK 227 P P Y P + +K Sbjct: 767 SSPPPPYYSPSPKVEYK 783 Score = 27.5 bits (58), Expect = 8.8 Identities = 30/102 (29%), Positives = 38/102 (37%), Gaps = 3/102 (2%) Frame = -1 Query: 457 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 278 P SS P PK TY P +VY P P S P VV + P Y + Sbjct: 433 PPPYVYSSPPPPYYSPSPKLTYKSSPPP---YVYSSPPPPYYS-PSPKVVYKSPPPPYVY 488 Query: 277 DRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNI---PHYTP 161 P P Y P +K PY++N P+Y+P Sbjct: 489 SSPPPPYYSPSPKPSYKSPPP-------PYVYNSPPPPYYSP 523 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,898,113 Number of Sequences: 28952 Number of extensions: 272584 Number of successful extensions: 969 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -