BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31081 (450 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42150.1 68415.m05217 DNA-binding bromodomain-containing prot... 27 4.4 At1g73990.1 68414.m08569 peptidase U7 family protein similar to ... 27 5.9 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 27 5.9 At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR... 27 7.7 >At2g42150.1 68415.m05217 DNA-binding bromodomain-containing protein contains Pfam domains, PF00439: Bromodomain and PF00249: Myb-like DNA-binding domain Length = 631 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 384 LEKKKKKNSRGGPVPNSP 437 LE+KK+++ G PVPN P Sbjct: 140 LERKKERSDSGEPVPNPP 157 >At1g73990.1 68414.m08569 peptidase U7 family protein similar to protease IV GB:AAA57008 from [Escherichia coli]; contains Pfam profile PF01343: Peptidase family U7 Length = 677 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +2 Query: 119 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVG 271 +I +DVA G +Y+ N I+AE ++G + YE +G Sbjct: 450 VIASMSDVAASGGYYMAMAANAIVAENLTLTGSIGVVTARFTLAKLYEKIG 500 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 173 TENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 298 TE ++L E+ K+E + E EG+K E D T + D Sbjct: 966 TETQVLVEDTQKIEALTEEVEGLKANLEQEKQRADDATRKFD 1007 >At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1179 Score = 26.6 bits (56), Expect = 7.7 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = -3 Query: 355 DLLR---DVSSVSNETVFVS-SVVYSVGDTVGANVFVESLDLDAFVFGANVLDLAGFFSE 188 D+LR D +S++ VF+ + + GD VES D +A + + DLA F Sbjct: 445 DVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLI 504 Query: 187 NLVLGLVQV 161 N+ G V++ Sbjct: 505 NISGGRVEM 513 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,234,101 Number of Sequences: 28952 Number of extensions: 134390 Number of successful extensions: 470 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -