BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31073 (822 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 2.6 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 23 3.4 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 3.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 4.5 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 22 6.0 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 6.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 6.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 6.0 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 588 NNCQKYFLCIDGHPRVLYCGGESAFDDLTST 680 NN Y ++G+ ++Y + +F LTS+ Sbjct: 196 NNTWVYIADVEGYALIIYNNADDSFQRLTSS 226 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 366 DARNCSGFRNCVNGVGYDFV 425 D++N GF V G+GYDF+ Sbjct: 251 DSQNEVGFYE-VEGIGYDFI 269 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 86 ILEAICLSKRLILCLCVNKGAKARQDHK 3 I A+CL++R I N+ K +++HK Sbjct: 41 IAHALCLTERQIKIWFQNRRMKWKKEHK 68 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +3 Query: 426 CPDGLAFNSETYRCEWPDEVADCDAE 503 CPDGL S+ C D + D + Sbjct: 64 CPDGLKLLSDGLMCVEKDSIHSIDGD 89 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 501 QHRSRRLHQAIRSGRSQN*KPVRRDIQNRSLHRSR 397 QH S R + R R +N + ++D Q LH + Sbjct: 225 QHTSSRYSRERRCSRDRNREYRKKDRQYEKLHNEK 259 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 3 FVILTCFCAFVYTQTQ 50 F++L FCA Y Q Sbjct: 3 FIVLVLFCAVAYVSAQ 18 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 6.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 Query: 313 GCSEDRSRHGTSLGYWHGYTSKFTLG 236 GC G++L W + TLG Sbjct: 19 GCGPPEEETGSNLPVWEAAAASLTLG 44 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 6.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 Query: 313 GCSEDRSRHGTSLGYWHGYTSKFTLG 236 GC G++L W + TLG Sbjct: 19 GCGPPEEETGSNLPVWEAAAASLTLG 44 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 6.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 315 PQPTELCPHQFGYF 356 P T+ CP QFG F Sbjct: 138 PMDTQRCPLQFGSF 151 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 6.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 Query: 313 GCSEDRSRHGTSLGYWHGYTSKFTLG 236 GC G++L W + TLG Sbjct: 19 GCGPPEEETGSNLPVWEAAAASLTLG 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,065 Number of Sequences: 438 Number of extensions: 5932 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -