BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31070 (575 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 29 0.37 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 26 3.4 SPBC29B5.04c |||conserved fungal protein|Schizosaccharomyces pom... 25 6.0 SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces po... 25 6.0 SPAC227.18 |lys3|SPAC2F7.01|saccharopine dehydrogenase [NAD+, L-... 25 7.9 SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha... 25 7.9 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 29.5 bits (63), Expect = 0.37 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 420 HNPVLRLHYLNLSREFRSLARGGGDL--RNRFTLSMVSSLVSEVRN 289 HNP L L +SRE SL D + R TL +S+LVS +N Sbjct: 255 HNPSTLLSILPISRELNSLLNRIFDRNPKTRITLPELSTLVSNCKN 300 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 26.2 bits (55), Expect = 3.4 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -3 Query: 318 VSSLVSEVRNGFRFAVSVRV-TVASTHSNNNVRLVVVVESLLQLTS 184 V SL ++ + R A V TVA +N+ RL VV++SLL + S Sbjct: 1288 VDSLPTDANDRLREATVVLFGTVAQHLPSNDPRLAVVMDSLLSVLS 1333 >SPBC29B5.04c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 25.4 bits (53), Expect = 6.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 181 ETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETI 291 ETG E D++ V+V + + DGKP I Sbjct: 85 ETGTYPEKDDENTNLQVVVDTKAQLNVNVNDGKPNDI 121 >SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 25.4 bits (53), Expect = 6.0 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 333 FTLSMVSSLVSEVRNGFRFAVSVRVTVASTHSNNNVRLVVVVESLL-QLT 187 F+ ++ L + +G +AVS++ + ++ N+ +L ++ SLL Q+T Sbjct: 247 FSAEFLNGLTDHMDSGIDYAVSLQKLIDASMDKNSQKLARLIFSLLYQIT 296 >SPAC227.18 |lys3|SPAC2F7.01|saccharopine dehydrogenase [NAD+, L-lysine forming] |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 25.0 bits (52), Expect = 7.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 193 LKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADETG 315 LKE ++DN P ++ ++ Y N +G E ++ F G Sbjct: 76 LKELPENDNSPLKHTHIQFAHCYKNQEGWREVLSRFPAGNG 116 >SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 453 Score = 25.0 bits (52), Expect = 7.9 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 Query: 136 AYNYNFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETI 291 A N + ++ +++++D +PHV+VA G + ETI Sbjct: 97 ALGANLNLKHALIVGGMDMIRQSIDLSKRPHVVVATPGRLADLIRSNGEETI 148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,109,009 Number of Sequences: 5004 Number of extensions: 38678 Number of successful extensions: 119 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -