BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31070 (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 66 3e-13 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.2 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 23 1.6 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 3.8 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 6.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 8.7 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 65.7 bits (153), Expect = 3e-13 Identities = 36/81 (44%), Positives = 48/81 (59%) Frame = +1 Query: 100 IVRSEFDASPDGAYNYNFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGK 279 I + + + DG Y NFETSNGI E+G+ K+ DN+ V+ +GS SYT DG+ Sbjct: 29 ITSQQLEVNFDGNYINNFETSNGISHQESGQPKQV---DNETPVVS--QGSDSYTAPDGQ 83 Query: 280 PETITYFADETGYHAQGESIP 342 +ITY ADE G+ QG IP Sbjct: 84 QVSITYVADENGFQVQGSHIP 104 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 157 TSNGIVRSETGELKEAL 207 TS G R TGE+KEA+ Sbjct: 403 TSKGEYRMSTGEMKEAI 419 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = -1 Query: 563 FLYQMNFIVFVHDILKTQQIVKKNVQKNMAVSIKLITSNKRMWWMLRHT 417 F Y+ +V + + KT + + + N+A+S+ L + ++W+ R T Sbjct: 15 FTYEQ--LVALENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRT 61 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 225 RLVVVVESLLQLTSFATHDAVGSLEIVVVSSIGAGV 118 RL + +L FA+H+ VGS + V + AG+ Sbjct: 460 RLKAIRATLKASPFFASHEVVGSSLLFVHDTKNAGI 495 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 225 RLVVVVESLLQLTSFATHDAVGSLEIVVVSSIGAGV 118 RL + +L FA+H+ VGS + V + AG+ Sbjct: 375 RLKAIRATLKASPFFASHEVVGSSLLFVHDTKNAGI 410 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 225 RLVVVVESLLQLTSFATHDAVGSLEIVVVSSIGAGV 118 RL + +L FA+H+ VGS + V + AG+ Sbjct: 694 RLKAIRATLKASPFFASHEVVGSSLLFVHDTKNAGI 729 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 275 ANLKPLRTSLTRLDTMLRVNLFLRS 349 A ++P + T ++RVNLF+RS Sbjct: 45 ARIRPSGENATDGPAIVRVNLFVRS 69 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 275 ANLKPLRTSLTRLDTMLRVNLFLRS 349 A ++P + T ++RVN+F+RS Sbjct: 45 ARIRPSGENATDGPAVVRVNIFVRS 69 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.7 Identities = 5/18 (27%), Positives = 14/18 (77%) Frame = +2 Query: 137 LTTTISRLPTASCVAKLV 190 +T ++ +PT +C+A+++ Sbjct: 385 ITESLRLIPTTTCIARIL 402 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,204 Number of Sequences: 438 Number of extensions: 2883 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -