BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31069 (780 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0199 - 6347980-6348225,6348300-6348341,6348824-6348978,634... 29 5.5 02_01_0560 - 4117565-4118176,4118443-4118477,4118836-4118962 28 9.6 >03_02_0199 - 6347980-6348225,6348300-6348341,6348824-6348978, 6349369-6349475,6349608-6349733,6349809-6349890, 6350057-6350130,6351184-6352631,6353391-6353540, 6353664-6353906,6354009-6354266,6355554-6356015 Length = 1130 Score = 28.7 bits (61), Expect = 5.5 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = -1 Query: 687 KDPSGAGAGR*YHIKRTFNYKDKYHVLSKMSRIKRNSPVTVLVEPDACDEGLDERINP 514 K P+G G ++ +++D+ SKM +I R + + V E CDEG+D++ P Sbjct: 346 KQPAGYG----FYFPAKDDHEDEDTSNSKMKKISRLALI-VEEERSLCDEGVDQQTTP 398 >02_01_0560 - 4117565-4118176,4118443-4118477,4118836-4118962 Length = 257 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 590 LSEIHRSPSSSNPTLATKGSTSELTH 513 L+++HR+ + + LA KG ELTH Sbjct: 211 LAKVHRNQNRISHVLANKGRVEELTH 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,656,212 Number of Sequences: 37544 Number of extensions: 292880 Number of successful extensions: 549 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -