BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31051 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0024 - 19934529-19935298,19935359-19935871,19936147-199366... 29 3.9 01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178 29 5.1 >03_05_0024 - 19934529-19935298,19935359-19935871,19936147-19936635, 19936738-19937044,19937104-19937130 Length = 701 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 93 ITPIVCMSTLLSEEVHNHYNSAIN 22 + I + TLL E+VHNH S IN Sbjct: 127 VAAITLLDTLLQEDVHNHVLSIIN 150 >01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178 Length = 605 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 603 KVTLL*ESHLNCAKSNLYMLKKYLGIFKSVFNKYGFLQI*HKI 475 K L + H C KS L + K L +V+ K G+ + HK+ Sbjct: 361 KFELCIQLHAYCYKSGLCLYKPVLNTLIAVYGKCGYATLAHKV 403 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,226,646 Number of Sequences: 37544 Number of extensions: 228979 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -