BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31051 (742 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) 28 6.9 SB_6538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) Length = 664 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 165 EHGKYISLIYNLNNMNSTNTY*HYITPIVCMSTLLSEEVHNHY 37 E+G YI+ N N+ ++++ Y YIT V + + + + HY Sbjct: 605 EYGHYITWKVNYNDSSNSDEYGQYITWKVIYNDSSNSDEYGHY 647 >SB_6538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 927 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -3 Query: 431 YRNKEKMKKVYLKKISEFLLYQILLKVHSYKQK-NQTESISNA 306 YR K+K K +++I+ +L+Y ++L + Y K +Q I+N+ Sbjct: 766 YRLKQKEMKAIIREITLYLIYLMVLTIVVYGSKDSQAFPITNS 808 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,152,064 Number of Sequences: 59808 Number of extensions: 314658 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -