BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31048 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 31 0.047 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 3.1 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 5.4 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 24 5.4 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 7.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.5 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 30.7 bits (66), Expect = 0.047 Identities = 15/52 (28%), Positives = 31/52 (59%) Frame = -1 Query: 512 NSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSER 357 + K+++ ++ +EL E++ E ++ +PQ ++ED EDE+K + T R Sbjct: 1023 SKKAKDMSLDAELRENAVEIARRLQ-RPKPQWDEEDLEDEQKAIGRRDTIHR 1073 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 467 DSYEDNETIEIEVRPQTEDEDDE 399 D+ ED+E E E + + EDED+E Sbjct: 962 DAAEDDEEEEEEEQEEEEDEDEE 984 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.6 bits (51), Expect = 3.1 Identities = 17/77 (22%), Positives = 32/77 (41%) Frame = -1 Query: 551 YENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKY 372 Y +LY +LP + ER E H + E E R + + E E + R+ Sbjct: 421 YPPNLYGMLPGMGMQSIHERMKLEEEHRAARLREEERAREAREAAIEREKERELREQRER 480 Query: 371 ATSERQTKAQQKYTPDE 321 E++ + +++ +E Sbjct: 481 EQREKEQREKEQREKEE 497 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 458 EDNETIEIEVRPQTEDEDDEDERKPFRKYATSE 360 E++E E E EDE+DED+ TS+ Sbjct: 484 EEDEEDEYEGDDTEEDEEDEDDELAAGPLGTSD 516 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 479 ELHEDSYEDNETIEIEVRPQTEDEDDEDE 393 E E + E E EDEDDED+ Sbjct: 358 EAEERKKAEGEAAAEEAAKDDEDEDDEDD 386 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 611 PSLTLFHCFFLYSLI 655 P LFHC FL+ ++ Sbjct: 706 PGFWLFHCHFLFHIV 720 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 687 WNDLNMEDKKQIREYKKKQWNNVRD 613 WN +N E K RE ++ + V+D Sbjct: 1024 WNKINNEAHKTTREESQRIYKAVKD 1048 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,742 Number of Sequences: 2352 Number of extensions: 13814 Number of successful extensions: 38 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -