BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31048 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16620.1 68416.m02124 chloroplast outer membrane protein, put... 42 5e-04 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 40 0.002 At1g76720.1 68414.m08929 eukaryotic translation initiation facto... 35 0.047 At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)... 34 0.082 At4g22320.1 68417.m03227 expressed protein 32 0.44 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 32 0.44 At1g11690.1 68414.m01342 hypothetical protein 32 0.44 At4g10670.1 68417.m01743 transcription elongation factor-related... 31 0.58 At3g47910.1 68416.m05224 expressed protein low similarity to non... 31 0.58 At3g05900.1 68416.m00664 neurofilament protein-related similar t... 31 0.58 At3g25840.1 68416.m03219 protein kinase family protein contains ... 31 0.76 At5g60030.1 68418.m07527 expressed protein 31 1.0 At3g07020.2 68416.m00834 UDP-glucose:sterol glucosyltransferase ... 31 1.0 At3g07020.1 68416.m00833 UDP-glucose:sterol glucosyltransferase ... 31 1.0 At2g22795.1 68415.m02704 expressed protein 31 1.0 At2g22080.1 68415.m02622 expressed protein 31 1.0 At5g44280.1 68418.m05420 zinc finger (C3HC4-type RING finger) fa... 30 1.3 At4g02810.1 68417.m00381 expressed protein 30 1.3 At2g33400.1 68415.m04094 expressed protein 30 1.3 At1g32830.1 68414.m04046 hypothetical protein similar to At2g049... 30 1.3 At5g61470.1 68418.m07713 zinc finger (C2H2 type) family protein ... 30 1.8 At4g20280.1 68417.m02962 transcription initiation factor IID (TF... 30 1.8 At3g56150.1 68416.m06241 eukaryotic translation initiation facto... 30 1.8 At3g24140.1 68416.m03031 basic helix-loop-helix (bHLH) family pr... 30 1.8 At2g42190.1 68415.m05221 expressed protein ; similar to GP|9826|... 30 1.8 At1g02730.1 68414.m00226 cellulose synthase family protein simil... 30 1.8 At5g61070.1 68418.m07663 histone deacetylase family protein (HDA... 29 2.3 At5g03710.1 68418.m00331 hypothetical protein 29 2.3 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 29 2.3 At3g17160.1 68416.m02189 expressed protein 29 2.3 At1g65440.1 68414.m07424 glycine-rich protein 29 2.3 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.3 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 29 2.3 At5g57120.1 68418.m07132 expressed protein weak similarity to SP... 29 3.1 At4g23880.1 68417.m03433 expressed protein 29 3.1 At3g29075.1 68416.m03637 glycine-rich protein 29 3.1 At3g28770.1 68416.m03591 expressed protein 29 3.1 At2g21540.1 68415.m02563 SEC14 cytosolic factor, putative / phos... 29 3.1 At1g80810.1 68414.m09481 expressed protein similar to androgen-i... 29 3.1 At1g66070.1 68414.m07499 translation initiation factor-related s... 29 3.1 At5g40450.1 68418.m04905 expressed protein 29 4.1 At5g27120.1 68418.m03237 SAR DNA-binding protein, putative stron... 29 4.1 At1g79180.1 68414.m09232 myb family transcription factor (MYB63)... 29 4.1 At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-r... 28 5.4 At5g56950.1 68418.m07109 nucleosome assembly protein (NAP), puta... 28 5.4 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 28 5.4 At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recogniti... 28 5.4 At3g49470.1 68416.m05407 nascent polypeptide-associated complex ... 28 5.4 At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) cont... 28 5.4 At1g79840.1 68414.m09327 homeobox-leucine zipper protein 10 (HB-... 28 5.4 At1g67140.1 68414.m07638 expressed protein 28 5.4 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 28 7.1 At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative s... 28 7.1 At5g28080.1 68418.m03391 protein kinase family protein contains ... 28 7.1 At5g17910.1 68418.m02100 expressed protein 28 7.1 At4g31610.1 68417.m04490 transcriptional factor B3 family protei... 28 7.1 At3g51150.1 68416.m05601 kinesin motor family protein contains P... 28 7.1 At3g24560.3 68416.m03086 expressed protein contains Pfam profil... 28 7.1 At3g24560.2 68416.m03084 expressed protein contains Pfam profil... 28 7.1 At3g24560.1 68416.m03085 expressed protein contains Pfam profil... 28 7.1 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 28 7.1 At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor... 28 7.1 At1g75150.1 68414.m08729 expressed protein ; expression supporte... 28 7.1 At1g61140.1 68414.m06888 SNF2 domain-containing protein / helica... 28 7.1 At1g55050.1 68414.m06288 expressed protein ; expression supporte... 28 7.1 At5g63550.1 68418.m07976 expressed protein 27 9.4 At5g47090.1 68418.m05806 expressed protein 27 9.4 At5g39040.1 68418.m04724 ABC transporter (TAP2) TAP-like ABC tra... 27 9.4 At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar ... 27 9.4 At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar ... 27 9.4 At5g09850.1 68418.m01139 transcription elongation factor-related... 27 9.4 At5g09460.1 68418.m01095 expressed protein 27 9.4 At4g35335.1 68417.m05021 nucleotide-sugar transporter family pro... 27 9.4 At4g17620.1 68417.m02636 glycine-rich protein 27 9.4 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 27 9.4 At4g10770.1 68417.m01757 oligopeptide transporter OPT family pro... 27 9.4 At4g03565.1 68417.m00490 expressed protein 27 9.4 At2g45460.1 68415.m05654 forkhead-associated domain-containing p... 27 9.4 At2g25830.1 68415.m03099 YebC-related contains Pfam profile PF01... 27 9.4 At2g20950.3 68415.m02473 expressed protein 27 9.4 At2g20950.2 68415.m02472 expressed protein 27 9.4 At2g20950.1 68415.m02471 expressed protein 27 9.4 At1g08340.1 68414.m00922 rac GTPase activating protein, putative... 27 9.4 At1g07620.1 68414.m00817 GTP1/OBG family protein similar to SP|P... 27 9.4 >At3g16620.1 68416.m02124 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1089 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/112 (25%), Positives = 58/112 (51%), Gaps = 3/112 (2%) Frame = -1 Query: 527 LPVLQNSKSRERNMPSELHEDSYED-NETIEIEVRPQTEDEDDEDERKPFRKYATSE--R 357 LP+L +S + R ++L E Y+D ++ +++ +E+E + DE PF++ +E + Sbjct: 693 LPLLLSSLLQSRPQ-AKLPEQQYDDEDDEDDLDESSDSEEESEYDELPPFKRLTKAEMTK 751 Query: 356 QTKAQQKYTPDEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRS 201 +K+Q+K DE+ Y+ K+ +E + + +F +D N S + Sbjct: 752 LSKSQKKEYLDEMEYREKLFMKRQMKEERKRRKLLKKFAAEIKDMPNGYSEN 803 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 39.5 bits (88), Expect = 0.002 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYE-DNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQ 339 + + ++R+ + HED E NE +E E ++E D+E E +P K ++ K ++ Sbjct: 158 RKKRKKKRSEEKQDHEDVDELANEDLEHE---ESEFSDEESEEEPVGK--RDRKRHKKKK 212 Query: 338 KYTPDEIPYQILNITKQNTDDEVSYQDVDS 249 K +E+ ++NIT + V+Y D S Sbjct: 213 KSVDEELESDLMNITDDGESETVNYHDSPS 242 >At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1201 Score = 35.1 bits (77), Expect = 0.047 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = -1 Query: 434 EVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITKQNTDDEVSYQDV 255 +V + +D+DD E P + ++++K + + + + +L+ K+ TDD S D Sbjct: 71 KVTQKHDDDDDFTEAVPENGFVGKKKKSKGKNR--GGSVSFALLS-GKEETDDNESNGDK 127 Query: 254 DSQFLLSFRDDMNAMSRSQK 195 D + ++SF NA ++ +K Sbjct: 128 DDEPVISFTGKKNASNKGKK 147 >At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13) similar to RNA helicase GB:CAA09204 from [Arabidopsis thaliana]; identical to cDNA DEAD box RNA helicase, RH13 GI:3776002 Length = 832 Score = 34.3 bits (75), Expect = 0.082 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = -1 Query: 554 IYENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEV-------RPQTEDEDDED 396 I E D + LP +++ + + P + + + +E IE E R +DEDDE+ Sbjct: 70 IDEADYHLTLPTIESEITERKQSPEDDDDTNETVDEMIEGEEAEEDGEGRDDEDDEDDEE 129 Query: 395 ERKPFRKYATSERQTKAQQK 336 RK K A ++ K ++K Sbjct: 130 TRKKKEKKAKRNKEKKKEKK 149 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 31.9 bits (69), Expect = 0.44 Identities = 34/150 (22%), Positives = 67/150 (44%), Gaps = 2/150 (1%) Frame = -1 Query: 695 SHIGMI*TWKIKSKLGNIKRNNGITSETVTENI*TETKNTPVPKKKFIYENDLYFLLPVL 516 SH+ ++ W S+ GN + S + +E+ P P+++F Y + VL Sbjct: 70 SHL-LLYKWAPLSQNGNGNEDGKSESNSPSEDTVATVAEDP-PRRRF-----KYVPIAVL 122 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDE--RKPFRKYATSERQTKAQ 342 + K + + D E+++ I+ + + + ED+ DED+ + K A E + K Sbjct: 123 EEQKKEITEIEED---DKIEEDDKIDEDNKVEQEDKVDEDKTVEESSEKKAEVEVEEKPD 179 Query: 341 QKYTPDEIPYQILNITKQNTDDEVSYQDVD 252 P E Q+ Q+ +++V QD++ Sbjct: 180 INDVPMEDIQQVEEKIVQDDEEKVVRQDLN 209 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 31.9 bits (69), Expect = 0.44 Identities = 23/113 (20%), Positives = 45/113 (39%), Gaps = 6/113 (5%) Frame = -1 Query: 641 KRNNGITSETVTENI*TETKNTP------VPKKKFIYENDLYFLLPVLQNSKSRERNMPS 480 KR G T ++ TE T TK T P K P + + + + P+ Sbjct: 8 KRGVGTTVKSTTEETATATKETAPATKETAPATKETAPTITKETAPTKETAPATKETAPT 67 Query: 479 ELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDE 321 E S + + +E E+E +E+E++ + E + + +++ +E Sbjct: 68 RTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEEEEEGEEEEEEEEEEEEKEE 120 >At1g11690.1 68414.m01342 hypothetical protein Length = 247 Score = 31.9 bits (69), Expect = 0.44 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 5/96 (5%) Frame = -1 Query: 569 PKKKFIYENDLYF-LLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDE 393 P + F + L F L+P LQ + + EL + ++ ETI +R Q ++ E+ Sbjct: 20 PSENFQEDEFLDFNLVPCLQTELWKAQTRIKELEAEKFKSEETIRCLIRNQRNEK--EET 77 Query: 392 RKPFRKY----ATSERQTKAQQKYTPDEIPYQILNI 297 PF Y + ER+ K + K + +IL++ Sbjct: 78 TNPFVDYLKEKLSKEREEKKRVKAENSRLKKKILDM 113 >At4g10670.1 68417.m01743 transcription elongation factor-related low similarity to chromatin-specific transcription elongation factor FACT 140 kDa subunit [Homo sapiens] GI:5499741 Length = 470 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITK 291 EDS + E ++EV ++EDE E E + SE++++ ++ T E+ + N + Sbjct: 363 EDSDKGYEPSDVEVESESEDETSESESDDEEEEEDSEQESEEEKGKTWAELEREATNADR 422 Query: 290 QN 285 ++ Sbjct: 423 EH 424 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 485 PSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKA 345 PS++ +S ++ET E E + E+ED E E + + +E + +A Sbjct: 371 PSDVEVESESEDETSESESDDEEEEEDSEQESEEEKGKTWAELEREA 417 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 31.5 bits (68), Expect = 0.58 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 524 PVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDER 390 P +NSKS+ E H ++ +N + + Q + EDD++ER Sbjct: 1174 PETENSKSQLSGTNGERHSETLRNNGDVGTKTLRQLQAEDDDEER 1218 >At3g05900.1 68416.m00664 neurofilament protein-related similar to NF-180 (GI:632549) [Petromyzon marinus] similar to Neurofilament triplet H protein (200 kDa neurofilament protein) (Neurofilament heavy polypeptide) (NF-H) (Swiss-Prot:P12036) [Homo sapiens] Length = 673 Score = 31.5 bits (68), Expect = 0.58 Identities = 19/84 (22%), Positives = 44/84 (52%), Gaps = 5/84 (5%) Frame = -1 Query: 494 RNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQ-----KYT 330 R++ +E+ E+ +D E +E+E +P+T E E + + R+ T KA++ + Sbjct: 222 RDVSAEIAEEKVKDVEALEVEPKPET-SEKVETQLEKARELETEVEVVKAEETAEATEQA 280 Query: 329 PDEIPYQILNITKQNTDDEVSYQD 258 E+ ++ ++ + D E++ +D Sbjct: 281 KVELEGKLEDVIVEEKDSEINSKD 304 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 31.1 bits (67), Expect = 0.76 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = -1 Query: 548 ENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYA 369 END + VL+ +S+ER+M E S D ++ + R + D E ER+ R+ Sbjct: 243 ENDRQYSREVLERDRSKERDMD---REGSIRDRDSEGSKRRDKDSDRRREREREKRREIE 299 Query: 368 TSERQTKAQQK 336 + + K +++ Sbjct: 300 SDRERRKEKER 310 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 30.7 bits (66), Expect = 1.0 Identities = 28/130 (21%), Positives = 59/130 (45%), Gaps = 3/130 (2%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYAT---SERQTKA 345 Q S+ R + + + +D + ++ +V+ + EDE +RK +K + ++ Sbjct: 141 QRSEERRERKKEKKKKKNNKDEDVVDEKVKEKLEDEQKSADRKERKKKKSKKNNDEDVVD 200 Query: 344 QQKYTPDEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFKLGMIQL 165 +++ DE + K+N D++V VD + D+ + R ++ K K + Sbjct: 201 EKEKLEDEQKSAEIKEKKKNKDEDV----VDEKEKEKLEDEQRSGERKKEKKKKRKSDEE 256 Query: 164 IQHVTEDRVS 135 I V+E+R S Sbjct: 257 I--VSEERKS 264 >At3g07020.2 68416.m00834 UDP-glucose:sterol glucosyltransferase (UGT80A2) identical to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 637 Score = 30.7 bits (66), Expect = 1.0 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -1 Query: 335 YTP-DEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFK 183 +TP E P+ + + KQ +SYQ VDS L RD +N + R +KLK + Sbjct: 332 WTPTSEFPHPLSRV-KQPAGYRLSYQIVDSLIWLGIRDMVNDL-RKKKLKLR 381 >At3g07020.1 68416.m00833 UDP-glucose:sterol glucosyltransferase (UGT80A2) identical to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 637 Score = 30.7 bits (66), Expect = 1.0 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -1 Query: 335 YTP-DEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFK 183 +TP E P+ + + KQ +SYQ VDS L RD +N + R +KLK + Sbjct: 332 WTPTSEFPHPLSRV-KQPAGYRLSYQIVDSLIWLGIRDMVNDL-RKKKLKLR 381 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/63 (22%), Positives = 34/63 (53%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYT 330 ++++E+ S E ++NE IE E E+ +++ K ++ + S+ +TK ++ T Sbjct: 563 TETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEKIEKEESASQEETKEKETET 622 Query: 329 PDE 321 ++ Sbjct: 623 KEK 625 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/91 (20%), Positives = 47/91 (51%), Gaps = 1/91 (1%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIE-IEVRPQTEDEDDEDERKPFRKYATSERQTKAQQ 339 + +++++ S E ++NE IE E Q E +++E E K ++ ++S+ +TK ++ Sbjct: 523 KETETKDNEESSSQEETKDKENEKIEKEEASSQEESKENETETKE-KEESSSQEETKEKE 581 Query: 338 KYTPDEIPYQILNITKQNTDDEVSYQDVDSQ 246 ++ TK+ ++++ ++ SQ Sbjct: 582 NEKIEKEESAPQEETKEKENEKIEKEESASQ 612 >At2g22080.1 68415.m02622 expressed protein Length = 177 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 458 EDNETIEIEVRPQTEDEDDEDERKPFRK 375 +D+E E+E + EDEDDE+ +P +K Sbjct: 147 DDDEDAEVEEEEEEEDEDDEEALQPPKK 174 >At5g44280.1 68418.m05420 zinc finger (C3HC4-type RING finger) family protein contains similarity to polycomb-M33 interacting protein Ring1B [Mus musculus] GI:2239142; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 486 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTK 348 +NS++ E+ SE HED D+ + + DE + R+ R+ ++ R T+ Sbjct: 265 RNSRNMEQQNASEAHEDDDNDDNNNRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQ 320 >At4g02810.1 68417.m00381 expressed protein Length = 271 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 512 NSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERK 387 NS+ E E +D Y+ E E E + E+E++E+E + Sbjct: 174 NSQDAEEEFEEEDEDDQYDAEEEEEEEEEEEEEEEEEEEEEE 215 >At2g33400.1 68415.m04094 expressed protein Length = 272 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITK 291 ED Y DNE + E EDE++E+E + + + AQ K P ++ + K Sbjct: 161 EDYYTDNEN-DYEDDADDEDEEEEEENEQDVAPLLNPVENLAQWKAVKAR-PVKVKRVMK 218 Query: 290 QNTDDEVSYQ 261 +N ++++ Q Sbjct: 219 ENVEEDMDDQ 228 >At1g32830.1 68414.m04046 hypothetical protein similar to At2g04970, At2g15200, At2g14140, At3g30450, At4g03990, At5g34895, At3g47270, At2g02200 Length = 707 Score = 30.3 bits (65), Expect = 1.3 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 5/116 (4%) Frame = -1 Query: 635 NNGITSETVTENI*TETKNTPVPKKKFIYENDLYFLLP-----VLQNSKSRERNMPSELH 471 NNG T+ T E+ + K T VPK++ + E+D + V+ + P+E Sbjct: 497 NNG-TAPTEKESHPLKEKTTEVPKEETVEEHDEHDETEDQEAYVILSDDEDNGTAPTE-K 554 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQIL 303 E + ET E+ + +DED ++ ++ Q+ Q TP + +++ Sbjct: 555 ESQPQKEETTEVPRETKKDDEDVNQTPLSTQEEEITQGQSSLQTPLTPVMLSQEVM 610 >At5g61470.1 68418.m07713 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 304 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 7/72 (9%) Frame = -1 Query: 518 LQNSKSRERNMPSELHEDSYEDNE-------TIEIEVRPQTEDEDDEDERKPFRKYATSE 360 + + ++ E + + ED EDNE T ++E DEDD+D Y Sbjct: 160 IDSDENHEDSDDEYVVEDEDEDNEDDDVKSLTSDVENLIGDSDEDDDDYGDENAYYGGKR 219 Query: 359 RQTKAQQKYTPD 324 ++ K Q KYT D Sbjct: 220 KRGKKQSKYTCD 231 >At4g20280.1 68417.m02962 transcription initiation factor IID (TFIID) 28 kDa subunit (TAFII-28) family protein similar to SP|Q15544 Transcription initiation factor TFIID 28 kDa subunit (TAFII-28) (TAFII28) (TFIID subunit p30-beta) {Homo sapiens}; contains Pfam profile PF04719: hTAFII28-like protein conserved region Length = 210 Score = 29.9 bits (64), Expect = 1.8 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 4/97 (4%) Frame = -1 Query: 467 DSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATS----ERQTKAQQKYTPDEIPYQILN 300 D ED IEI+ + Q EDE D R+P +K TS E + K + + +E + Sbjct: 32 DGSEDGR-IEID-QTQDEDERPVDVRRPMKKAKTSVVVTEAKNKDKDEDDEEEEENMDVE 89 Query: 299 ITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLK 189 +TK T + + L F +D MSR + + Sbjct: 90 LTKYPTSSDPAKMAKMQTILSQFTEDQ--MSRYESFR 124 >At3g56150.1 68416.m06241 eukaryotic translation initiation factor 3 subunit 8 / eIF3 p110 / eIF3c / p105 (TIF3C1) nearly identical to SP|O49160 Eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) (eIF3c) (p105) {Arabidopsis thaliana} Length = 900 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -1 Query: 512 NSKSRERNMPSELHEDS---YEDNETIEIEVRPQTEDEDDEDE 393 NS ++ ++L+ED Y + +E E +P+ +D+DD+D+ Sbjct: 142 NSMKQKLKKNNKLYEDDINKYREAPEVEEEKQPEDDDDDDDDD 184 >At3g24140.1 68416.m03031 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 414 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 6/95 (6%) Frame = -1 Query: 575 PVPKKKFIYENDLYFLLPVLQNSKSRER------NMPSELHEDSYEDNETIEIEVRPQTE 414 PV K N L+P Q S+ N+ E ED +DN+ +++R Sbjct: 102 PVLNDKIEDHNQTQHLMPSHQTSQEGGECGGNIGNVFLEEKEDQDDDNDNNSVQLRFIGG 161 Query: 413 DEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQ 309 +E+D + + +K S+R+ +A+ T +E+ Q Sbjct: 162 EEEDRENKNVTKKEVKSKRK-RARTSKTSEEVESQ 195 >At2g42190.1 68415.m05221 expressed protein ; similar to GP|9826|X07453 Length = 141 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/84 (25%), Positives = 36/84 (42%) Frame = -1 Query: 527 LPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTK 348 +P + ++ M + E+ ED+E E+ + + EDED+E + ER+ K Sbjct: 27 IPAYRRRGRPQKPMKDDFEEEEEEDDE--EMVEKMEVEDEDEEIDDGSVTSKDLKERKRK 84 Query: 347 AQQKYTPDEIPYQILNITKQNTDD 276 D + +K NTDD Sbjct: 85 MSNGSNTDLTEEENGLGSKPNTDD 108 >At1g02730.1 68414.m00226 cellulose synthase family protein similar to cellulose synthase catalytic subunit [gi:13925881] from Nicotiana alata, cellulose synthase-4 [gi:9622880] from Zea mays Length = 1181 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 440 EIEVRPQTEDEDDEDERKPFRKYATSE 360 +I P+TE+ED+EDE KP + S+ Sbjct: 207 DINDDPETEEEDEEDEAKPLPQMGESK 233 >At5g61070.1 68418.m07663 histone deacetylase family protein (HDA18) identical to HDA18 [Arabidopsis thaliana] GI:21105769; similar to SP|Q9UBN7 Histone deacetylase 6 (HD6) {Homo sapiens}; contains Pfam profile PF00850: Histone deacetylase family Length = 682 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = -1 Query: 518 LQNSKSRER--NMPSELHEDSYEDNETIEIE-VRPQTEDEDDEDERKPFRKYATSERQTK 348 LQ +SR R N ++ YED + E+E + P+ ++ D +E +PF+ + + Sbjct: 602 LQEDRSRSRVGNGSFAFSQEFYEDMDLDELEPLSPEFNEDMDSEELEPFQ--VIKKNMER 659 Query: 347 AQQKYTPD 324 + +K+ D Sbjct: 660 SHKKFIKD 667 >At5g03710.1 68418.m00331 hypothetical protein Length = 81 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKA 345 + + E E E+ E+ E E E + E+E++E+E + + ER+ +A Sbjct: 18 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDREREERA 74 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYA 369 + + E E E+ E+ E E E + E+E++ED + R +A Sbjct: 28 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDREREERAFA 76 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/60 (20%), Positives = 28/60 (46%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 + + E E E+ E+ E E E + E+E++E+E + + E + + +++ Sbjct: 6 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 65 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = -1 Query: 497 ERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDE 321 E E E+ E+ E E E + E+E++E+E + + E + + +++ +E Sbjct: 6 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 64 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/61 (21%), Positives = 28/61 (45%) Frame = -1 Query: 506 KSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTP 327 + E E E+ E+ E E E + E+E++E+E + + E + + +++ Sbjct: 7 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 66 Query: 326 D 324 D Sbjct: 67 D 67 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/60 (20%), Positives = 28/60 (46%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 + + E E E+ E+ E E E + E+E++E+E + + E + + +++ Sbjct: 7 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 66 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = -1 Query: 497 ERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDE 321 E E E+ E+ E E E + E+E++E+E + + E + + +++ +E Sbjct: 7 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 65 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/65 (20%), Positives = 29/65 (44%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 + + E E E+ E+ E E E + E+E++E+E + + E + + ++ Sbjct: 8 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEED 67 Query: 335 YTPDE 321 +E Sbjct: 68 REREE 72 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = -1 Query: 551 YENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDE 393 Y L +P + + ++ S + E+S +D + E EV+P+ E+E++EDE Sbjct: 34 YLESLGAKIPTGVHEEDKDTKPRSFVVEESDDDMDETE-EVKPKVEEEEEEDE 85 >At3g17160.1 68416.m02189 expressed protein Length = 165 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/88 (21%), Positives = 36/88 (40%) Frame = -1 Query: 497 ERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEI 318 E N+ E E ED++ + + EDEDDE+ + + + + + Sbjct: 45 EANVEEEDDEAENEDDDDDDDDDDDDDEDEDDEEGEEDLGTEYLVRPVGEVEDEDDASDF 104 Query: 317 PYQILNITKQNTDDEVSYQDVDSQFLLS 234 + + ++ D+E+ DVD LS Sbjct: 105 DPEENGLDEEEGDEEIEEDDVDEDISLS 132 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 416 EDEDDEDERKPFRKYATSERQTKAQQKYTPDE 321 EDE++E+E RK + ERQ K +++ DE Sbjct: 56 EDEEEEEEEDEERKDSDEERQKKKKKRKKKDE 87 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 + K +ER E ++ E EI + E+EDD+D R+ + + A ER+ + ++ Sbjct: 488 EREKEKERQYEKEKEKEK-ERKRKKEIRYEEE-EEEDDDDSRRRWHRAALDERRRRQLRE 545 Query: 335 YTPD 324 D Sbjct: 546 KEDD 549 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -1 Query: 530 LLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDE 393 LLP +K + M S D ED++ E ++ + ED+ D+D+ Sbjct: 91 LLPKFDVTKIPKNWMDSSSSSDESEDDDDDEKSIKEECEDDGDDDD 136 >At5g57120.1 68418.m07132 expressed protein weak similarity to SP|Q14978 Nucleolar phosphoprotein p130 {Homo sapiens} Length = 330 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDED-ERKPFRKYATSE 360 SK R+R+ P E E++ +D+E + + + E+DE + P ++ T E Sbjct: 174 SKKRKRSEPEETKEETEDDDEESKRRKKEENVVENDEGVQETPVKETETKE 224 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/90 (20%), Positives = 40/90 (44%), Gaps = 4/90 (4%) Frame = -1 Query: 644 IKRNNGITSETVTENI*TETKNTPVPKKKFIYENDLYFLLPVLQNSKSRERNMPSELHED 465 +K + + + V E + V +++ + E D V + K + ++ E +D Sbjct: 110 VKETDAVIEDGVKEKKKKKETKVKVTEEEKVKETDAVIEDGVKEKKKKKSKSKSVEADDD 169 Query: 464 ----SYEDNETIEIEVRPQTEDEDDEDERK 387 S + + E + +TED+D+E +R+ Sbjct: 170 KEKVSKKRKRSEPEETKEETEDDDEESKRR 199 >At4g23880.1 68417.m03433 expressed protein Length = 199 Score = 29.1 bits (62), Expect = 3.1 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = -1 Query: 572 VPKKKFIYENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVR-PQTEDEDDED 396 V + K IY +DL LP+ ++S+E ++ S + + I+ +R + E+E+DE Sbjct: 19 VLEAKPIYRDDLDITLPL---NESKEVSVESTKKSRCLQRAKRIDKSLRFEEGEEEEDEQ 75 Query: 395 ERKPFRK 375 +KP K Sbjct: 76 NKKPLAK 82 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/62 (24%), Positives = 30/62 (48%) Frame = -1 Query: 506 KSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTP 327 K +++ E H+D D E + + +D +D+DE+K + Y + + K + Y Sbjct: 186 KKKKKEQYKEHHDDDDYD------EKKKKKKDYNDDDEKKKKKHYNDDDDEKKKKHNYND 239 Query: 326 DE 321 D+ Sbjct: 240 DD 241 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/84 (22%), Positives = 40/84 (47%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYT 330 SK+RE+ E + E+ + + + + + +E D +ERK +K R KA++K Sbjct: 1007 SKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKS-KKEKEESRDLKAKKKEE 1065 Query: 329 PDEIPYQILNITKQNTDDEVSYQD 258 + + N + +D+ ++D Sbjct: 1066 ETKEKKESENHKSKKKEDKKEHED 1089 >At2g21540.1 68415.m02563 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 548 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = -1 Query: 641 KRNNGITSETVTENI*TETKNTPVPKKKFIYENDLYFLLPVLQNSKSRERNMPSELHEDS 462 K + I +T++ + T K+ K KF EN + +P++ + + P+ LH+ + Sbjct: 342 KTLSNIEEKTISVDENTTMKSDSFAKNKFDAENTKF--IPMIDKTVNAS-TWPTNLHKSN 398 Query: 461 YEDNETIEIEVRP 423 Y + E + V+P Sbjct: 399 YPEPEDLYSAVKP 411 >At1g80810.1 68414.m09481 expressed protein similar to androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens]; similar to bimD (GI:168025) [Emericella nidulans] Length = 826 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/79 (20%), Positives = 36/79 (45%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYT 330 +K E+ P+ E ED+E+ E +T+D +D++E + + + +++ Sbjct: 740 TKEEEKQYPNSEGESEGEDSESEEEPKWRETDDMEDDEEEEEEEIDHMEDEAEEEKEEVD 799 Query: 329 PDEIPYQILNITKQNTDDE 273 E + I K+ ++E Sbjct: 800 DKEASANMSEIEKEEEEEE 818 >At1g66070.1 68414.m07499 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 226 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 488 MPSELH-EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 +P+++ + +++D + E E++ ED+DDE + P A + KA K Sbjct: 12 LPAKVELKSNWDDEDVDENEIKDSWEDDDDEPAQPPVINPAPEKAPKKAAPK 63 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = -1 Query: 482 SELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYT 330 SE+ ++S+ E++E++ + +DE+ ED+ + +T + + + T Sbjct: 723 SEIKDESHGKEESVEVKSQETVQDENTEDKHDVLKVPSTESEKYQGNEPET 773 >At5g27120.1 68418.m03237 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = -1 Query: 515 QNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQK 336 + K + ++ E S + + + E P+T +E + E+K RK+ E + A++K Sbjct: 461 KKKKKADDEEEAKTEEPSKKKSNKKKTEAEPETAEEPAKKEKKKKRKHEEEETEMPAKKK 520 >At1g79180.1 68414.m09232 myb family transcription factor (MYB63) similar to myb-related protein GI:1370139 from [Lycopersicon esculentum] Length = 294 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = -1 Query: 428 RPQTEDEDDEDERKPFRKYATSE---RQTKAQQKYTPDE 321 R TE+E DEDE K + K+ SE + QQ+Y +E Sbjct: 241 RATTEEESDEDEVKKWFKHLESELGLEEDDNQQQYKEEE 279 >At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1094 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/100 (18%), Positives = 45/100 (45%), Gaps = 3/100 (3%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQT---KAQQ 339 S + E ++ +EL ++ + E + + +PQ++ D ++KP ++S +T K Sbjct: 712 SDAAEADLLNELEKEKLQSKEKPQSKEKPQSKKRRDRSKKKPSTSISSSLDKTVEHKPSV 771 Query: 338 KYTPDEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDM 219 P+ + I + + + E + Q +S + ++ Sbjct: 772 NLKPESTSSSLRTIEEGSMEPEDALASETGQLKISSKTEI 811 >At5g56950.1 68418.m07109 nucleosome assembly protein (NAP), putative similar to nucleosome assembly protein 1 [Glycine max] GI:1161252; contains Pfam profile PF00956: Nucleosome assembly protein (NAP) Length = 374 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRK 375 ED +++E + E + E+EDDEDE + K Sbjct: 311 EDDIDEDEDEDEEDEDEDEEEDDEDEEEEVSK 342 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 485 PSELHEDSYEDNETIEIEVRPQTEDEDDED 396 P E ED D E E E ED+DD+D Sbjct: 149 PGEGSEDKSSDEELSEEEYGSDNEDDDDDD 178 >At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein contains Pfam profile PF02493: MORN repeat Length = 871 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -1 Query: 548 ENDLYFLLPVLQNSK--SRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKP 384 E D L+PV + K + + + E+ Y+D++ + + +D+DD+D+ P Sbjct: 650 EEDEDVLVPVYKEEKVVTAKEKIQENKQEEKYKDDDDEDDDDGDDDDDDDDDDDLGP 706 >At3g49470.1 68416.m05407 nascent polypeptide-associated complex (NAC) domain-containing protein similar to alpha-NAC, non-muscle form [Mus musculus] GI:1666690; contains Pfam profile PF01849: NAC domain Length = 217 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/82 (24%), Positives = 36/82 (43%) Frame = -1 Query: 419 TEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITKQNTDDEVSYQDVDSQFL 240 TE D + E+ P A + ++K DE + + + + DD+ +D D+Q + Sbjct: 9 TESADGQPEQPPVTAIAE-----ELEKKLQTDEPIVEDVKDDEDDDDDDEEEEDDDAQGV 63 Query: 239 LSFRDDMNAMSRSQKLKFKLGM 174 + +S+K KLGM Sbjct: 64 SGSSKQSRSEKKSRKAMLKLGM 85 >At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) contains Pfam domain PF00098: Zinc knuckle; identical to cDNA CAX-interacting protein 4 GI:27651998 Length = 332 Score = 28.3 bits (60), Expect = 5.4 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 6/111 (5%) Frame = -1 Query: 518 LQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDD------EDERKPFRKYATSER 357 ++ S +R SE ED E E R + DEDD ED+R+ RK +R Sbjct: 205 MKKRSSHKRRSLSE-SEDEEEGRSKRRKERRGRKRDEDDSDESEDEDDRRVKRKSRKEKR 263 Query: 356 QTKAQQKYTPDEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSR 204 + ++++ ++ D + +Q ++V+ DS+ +S DD++ + R Sbjct: 264 RRRSRRNHSDDSDSESSEDDRRQKRRNKVAASS-DSEANVS-GDDVSRVGR 312 >At1g79840.1 68414.m09327 homeobox-leucine zipper protein 10 (HB-10) / HD-ZIP transcription factor 10 / homeobox protein (GLABRA2) identical to homeobox protein (GLABRA2) (homeobox-leucine zipper protein ATHB-10) (HD-ZIP protein ATHB-10) GB:P46607 [Arabidopsis thaliana] Length = 747 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = -1 Query: 416 EDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITKQNTDDEVSYQDVDSQFLL 237 +DE++E+E T++R+ K ++T D+I + + DE Q + Q L Sbjct: 81 DDEEEEEEDGAAGNKGTNKRKRKKYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQLGL 140 Query: 236 SFR 228 + R Sbjct: 141 APR 143 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 28.3 bits (60), Expect = 5.4 Identities = 22/85 (25%), Positives = 42/85 (49%) Frame = -1 Query: 488 MPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQ 309 MP+ ++ S ++ T E E + +D+DD D + F +T+ ++++ + +E P Sbjct: 1933 MPTSFNQVSTVESGTDEEEEEEEDDDDDDWDTFQSF-PASTNLEGSESKTESVAEEEP-- 1989 Query: 308 ILNITKQNTDDEVSYQDVDSQFLLS 234 L DDE + ++ D Q L S Sbjct: 1990 DLPGRSSIQDDESNAEETDDQHLAS 2014 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 509 SKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTK 348 ++ R ++ E ED+ ED E R EDE++E+ + + + S R+ K Sbjct: 541 ARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEGGRAEKDHRGSGRKRK 594 >At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative similar to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 357 Score = 27.9 bits (59), Expect = 7.1 Identities = 22/99 (22%), Positives = 43/99 (43%), Gaps = 6/99 (6%) Frame = -1 Query: 455 DNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQ------QKYTPDEIPYQILNIT 294 + T E+E P E + EDE +K T+E + + + ++ T +E + Sbjct: 185 EEPTTEVEKSPVAEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTLEEYEKILEEKK 244 Query: 293 KQNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFKLG 177 K +V + VD++ S + N + +++ KLG Sbjct: 245 KALQATKVEERKVDTKVFESMQQLSNKKNTDEEIFIKLG 283 >At5g28080.1 68418.m03391 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 406 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/82 (17%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = -1 Query: 461 YEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITKQNT 282 Y +ET+E E ++D+DE + +++ + + K +++ D + ++ + K+ Sbjct: 244 YNGDETVESHEIDLLEFQNDDDEEEEDKRFGSVDISIKGKRRDNGDGLFLRLKTVNKEGC 303 Query: 281 DDEVSYQ-DVDSQFLLSFRDDM 219 + + D+++ +S +M Sbjct: 304 VRNIYFPFDIETDTAISVAREM 325 >At5g17910.1 68418.m02100 expressed protein Length = 1342 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -1 Query: 467 DSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYT 330 DS E + E + EDE++EDE + K + ++K+ K+T Sbjct: 313 DSESHGEEGDNENEDEEEDEEEEDEEEKQEKKEDKDDESKSAIKWT 358 >At4g31610.1 68417.m04490 transcriptional factor B3 family protein / reproductive meristem protein 1 (REM1) similar to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424; contains Pfam profile PF02362: B3 DNA binding domain; identical to cDNA reproductive meristem protein 1 (REM1) GI:13604226 Length = 517 Score = 27.9 bits (59), Expect = 7.1 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = -1 Query: 557 FIYENDLYFLLPVLQNSKSRE-RNMPSE--LHEDSYEDNETIEIEVRPQT-EDEDDEDER 390 F + D F + V+ S S + RN S + ED+Y D + ++ + Q ED+DD+D+ Sbjct: 76 FKHHGDEVFHVAVVSPSVSGDIRNASSSQVITEDTYIDVDDVDDDDYGQDDEDDDDDDDE 135 Query: 389 KPFRKYATSERQTKAQQ 339 SE+ K Q+ Sbjct: 136 GEDNIENISEKTDKRQE 152 >At3g51150.1 68416.m05601 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1025 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEI-PYQILNIT 294 ++S ET E + + +E +E+E + ++ ++ QTK +K P ++ P +L++T Sbjct: 578 KNSRPPTETAEEKEEKEETEEKEEEEEERVKEVSSVSIQTK--EKSGPIKVSPRCVLSLT 635 Query: 293 KQNTDDEVS 267 ++ DE S Sbjct: 636 DESFPDESS 644 >At3g24560.3 68416.m03086 expressed protein contains Pfam profile PF01171: PP-loop family Length = 456 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 449 RCLRNYLRVIPMACSVREICCFVKPVTKNKG 541 + L NY+R IP S+ C++ P +KG Sbjct: 177 KLLLNYIRAIPCRTSLTAAGCYLSPAPGSKG 207 >At3g24560.2 68416.m03084 expressed protein contains Pfam profile PF01171: PP-loop family Length = 660 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 449 RCLRNYLRVIPMACSVREICCFVKPVTKNKG 541 + L NY+R IP S+ C++ P +KG Sbjct: 381 KLLLNYIRAIPCRTSLTAAGCYLSPAPGSKG 411 >At3g24560.1 68416.m03085 expressed protein contains Pfam profile PF01171: PP-loop family Length = 462 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 449 RCLRNYLRVIPMACSVREICCFVKPVTKNKG 541 + L NY+R IP S+ C++ P +KG Sbjct: 183 KLLLNYIRAIPCRTSLTAAGCYLSPAPGSKG 213 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 27.9 bits (59), Expect = 7.1 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 6/88 (6%) Frame = -1 Query: 509 SKSRERNMPS--ELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSE--RQTKAQ 342 SK ++ N S EL Y+ ++ + V E +DD+D+RK R+ E + ++ + Sbjct: 153 SKRKKENGDSSGELRSCKYQKSD--DKSVATNNEGDDDDDKRKLIRQIRNRESAQLSRLR 210 Query: 341 QKYTPDEIPYQI--LNITKQNTDDEVSY 264 +K +E+ ++ +N T + +++Y Sbjct: 211 KKQQTEELERKVKSMNATIAELNGKIAY 238 >At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2 (CPK2) identical to calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 646 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/62 (19%), Positives = 31/62 (50%) Frame = -1 Query: 506 KSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTP 327 +++++ +P E ++ + E+ V+P++ + + E KP + +TK + K P Sbjct: 96 ETKQKVVPEESKQEVPPEESKREVVVQPESAKPETKSESKPETTKPETTSETKPETKAEP 155 Query: 326 DE 321 + Sbjct: 156 QK 157 >At1g75150.1 68414.m08729 expressed protein ; expression supported by MPSS Length = 753 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = -1 Query: 479 ELHEDSYEDNETIEIEVRPQTEDEDDEDER----KPFRKYAT-SERQTKAQQKY 333 + E+ DN+ + E EDEDD+D R F++ T +R+ + QK+ Sbjct: 413 DAEEEDDSDNDLLRFEDEDDDEDEDDDDLRDMIVSQFKEDPTDKDRRNELHQKW 466 >At1g61140.1 68414.m06888 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related similar to ATPase [Homo sapiens] GI:531196; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1287 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/19 (42%), Positives = 16/19 (84%) Frame = -1 Query: 464 SYEDNETIEIEVRPQTEDE 408 S++DN+T+ ++V+P+ E E Sbjct: 332 SFQDNKTVHVKVKPEAESE 350 >At1g55050.1 68414.m06288 expressed protein ; expression supported by MPSS Length = 914 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 527 LPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTE 414 L + NS + L+ + E+NE IEI+ RP+TE Sbjct: 608 LDQITNSHPKLHVDSMNLNTNQSEENENIEIQERPETE 645 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 27.5 bits (58), Expect = 9.4 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = -1 Query: 590 ETKNTPVPKKKFIYENDLYFLLPVLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTED 411 E+ +TP +K+ + DL ++ + ++ HE+ E + T+D Sbjct: 267 ESSDTPAKRKRQTKKRDLPSDTEEGKDEGDADSEGTNDPHEEDDAAPEEESDHEKTDTDD 326 Query: 410 EDDEDE-RKPFRKYATSER 357 E DE E KP +K ++S++ Sbjct: 327 EKDEVEVEKPSKKKSSSKK 345 >At5g47090.1 68418.m05806 expressed protein Length = 310 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/62 (24%), Positives = 32/62 (51%) Frame = -1 Query: 467 DSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITKQ 288 + E++E E E + E+E+DE+ + P ++S + ++K T P ++ ++ Q Sbjct: 202 EKMEESEEEEEEESEEEEEEEDEEAKNPTEASSSSLNGKEQKEKATTVLPPEEMQDMMDQ 261 Query: 287 NT 282 T Sbjct: 262 FT 263 >At5g39040.1 68418.m04724 ABC transporter (TAP2) TAP-like ABC transporter, Rattus norvegicus, EMBL:AB027520; identical to cDNA transporter associated with antigen processing-like protein (TAP2); GI:19335723 Length = 644 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 30 DRALYSALNCSFGRVFGVFLPNKGSLDVSTL 122 + + A N FGRVF + P+ G L + T+ Sbjct: 46 EHGVVEAANVGFGRVFALAKPDAGKLVIGTI 76 >At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1072 Score = 27.5 bits (58), Expect = 9.4 Identities = 26/109 (23%), Positives = 46/109 (42%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITK 291 +++Y E E +V Q E+D+DE + + A S+ + A PDE P + Sbjct: 12 DEAYSSEE--EEQVNDQANVEEDDDELEAVARSAGSDEEDVA-----PDEAPVSDDEVVP 64 Query: 290 QNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFKLGMIQLIQHVTED 144 D E +D + + +S R+ + K K+ I Q+ + D Sbjct: 65 VEDDAEEDEED-EEKAEISKREKARLKEMQKMKKQKIQQILDSQNASID 112 >At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1069 Score = 27.5 bits (58), Expect = 9.4 Identities = 26/109 (23%), Positives = 46/109 (42%) Frame = -1 Query: 470 EDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNITK 291 +++Y E E +V Q E+D+DE + + A S+ + A PDE P + Sbjct: 12 DEAYSSEE--EEQVNDQANVEEDDDELEAVARSAGSDEEDVA-----PDEAPVSDDEVVP 64 Query: 290 QNTDDEVSYQDVDSQFLLSFRDDMNAMSRSQKLKFKLGMIQLIQHVTED 144 D E +D + + +S R+ + K K+ I Q+ + D Sbjct: 65 VEDDAEEDEED-EEKAEISKREKARLKEMQKMKKQKIQQILDSQNASID 112 >At5g09850.1 68418.m01139 transcription elongation factor-related low similarity to SP|P10712 Transcription elongation factor S-II (Transcription elongation factor A) {Mus musculus} Length = 353 Score = 27.5 bits (58), Expect = 9.4 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 8/80 (10%) Frame = -1 Query: 476 LHEDSYEDNE-----TIEIEVRPQTEDEDDEDERKPFRKYATSERQT--KAQQKYTPDEI 318 +HE++ E++E E EVR ++ + +D+D+ PF E+++ + ++K ++ Sbjct: 80 VHEETEEEDEEGVTAAAEEEVREKSVNVEDDDDFDPFAGLFDDEQKSIVEIKEKLEDPDL 139 Query: 317 PYQILNITKQNTDD-EVSYQ 261 + L QN +D ++++Q Sbjct: 140 SEESLVELLQNLEDMDITFQ 159 >At5g09460.1 68418.m01095 expressed protein Length = 326 Score = 27.5 bits (58), Expect = 9.4 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%) Frame = -1 Query: 521 VLQNSKSRERNMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQ 342 +LQ+ SE+HED+ E N + ++D+D++D +T Sbjct: 147 ILQHEDHENGEEDSEMHEDTEEINALL------YSDDDDNDDWESDDEVMSTG------- 193 Query: 341 QKYTPDEIPYQILNITKQNTDDEVSYQD---VDSQFLL--SFRDDMNAMSRSQKLK 189 ++P + Q NIT + D+ S D + Q LL S+RD ++ + K+K Sbjct: 194 --HSPFTVEQQACNITTEELDETESTVDGPLLKRQKLLDHSYRDSSPSLVGTTKVK 247 >At4g35335.1 68417.m05021 nucleotide-sugar transporter family protein similar to SP|O77592 UDP N-acetylglucosamine transporter (Golgi UDP-GlcNAc transporter) {Canis familiaris}, SP|P78382 CMP-sialic acid transporter {Homo sapiens}; contains Pfam profile PF04142: Nucleotide-sugar transporter Length = 302 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -1 Query: 656 KLGNIKRNNGITSETVTENI*TETKNTPVPKKKFIYENDLYFLL 525 + G I +N G+T + E K P+P ++++N L + + Sbjct: 89 RAGKIWKNEGVTDDNRLSTTFDEVKVFPIPAALYLFKNLLQYYI 132 >At4g17620.1 68417.m02636 glycine-rich protein Length = 544 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -1 Query: 467 DSYEDNETIEIEVRP-QTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIP 315 +SY N+ E V P + E+E++EDE+ F +T A Y+ +P Sbjct: 88 ESYRSNDNGESGVYPYEEEEEEEEDEKDLFGSDNEEYTKTPAISTYSIPVLP 139 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 470 EDSYE-DNETIEIEVRPQTEDEDDEDERK 387 ED E D++ E E P+ E+E+DE+E + Sbjct: 68 EDMAEGDDDQAEEETNPEAEEEEDEEEEE 96 >At4g10770.1 68417.m01757 oligopeptide transporter OPT family protein similar to oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 766 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 530 LLPVLQNSKSRER-NMPSELHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYA 369 +LP+L N K + S S +ET ++ + E+E++E+E P R+ A Sbjct: 7 VLPLLTNPKDLTNPSYASSSSSSSEPRDETEDLLLPISDENEEEEEENSPIRQVA 61 >At4g03565.1 68417.m00490 expressed protein Length = 263 Score = 27.5 bits (58), Expect = 9.4 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Frame = -1 Query: 518 LQNSKSRERNMPS--ELHEDSYEDN--ETIEIEVRPQTEDEDDEDERKPFRKYATSERQ 354 + +S +RE + S E + YE N E E + E++DD+D+ + R+ +ER+ Sbjct: 23 ISDSDTREDDYSSDGEKEGEDYESNGEEGDEYDGESNEEEDDDDDDNESDREEGDTERE 81 >At2g45460.1 68415.m05654 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 915 Score = 27.5 bits (58), Expect = 9.4 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 3/105 (2%) Frame = -1 Query: 506 KSRERNMPSE--LHEDSYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKY 333 K ++++ SE E+++ +E+E+ D D E +R + R+T+ + Y Sbjct: 477 KRLQKDLDSEKAAREEAWAKVSALELEISAAVRDLDVERQRHRGARERIMLRETQMRAFY 536 Query: 332 -TPDEIPYQILNITKQNTDDEVSYQDVDSQFLLSFRDDMNAMSRS 201 T +EI +Q + + +D D+ S D+N ++RS Sbjct: 537 STTEEISALFAKQQEQLKTMQRTLEDEDNCDNTSLDIDLNPINRS 581 >At2g25830.1 68415.m03099 YebC-related contains Pfam profile PF01709: Domain of unknown function; contains TIGRFAM TIGR01033: conserved hypothetical protein; similar to YebC (GI:5771432) [Legionella pneumophila] Length = 331 Score = 27.5 bits (58), Expect = 9.4 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Frame = -1 Query: 425 PQTEDEDDEDERKPFRKYATS-ERQTKAQQKYTPDEIPY------QILNITKQNTDDEVS 267 P ED+ DED + + K TS E + K + + + ++L +T DDE Sbjct: 248 PTYEDDTDEDREERYYKIVTSNENYSTILSKLRDEGVNFEPDNGSELLPLTTVEVDDEAM 307 Query: 266 YQDVDSQFLLSFRDDMNAMSRSQK 195 + + L DD++A+ QK Sbjct: 308 ELNKELMQKLLELDDVDAVYIDQK 331 >At2g20950.3 68415.m02473 expressed protein Length = 505 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 419 TEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNI 297 ++DEDD + F + AT R TP YQI ++ Sbjct: 234 SDDEDDNNSTYLFPEIATGRRSRGVSGSSTPVHYKYQITSV 274 >At2g20950.2 68415.m02472 expressed protein Length = 503 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 419 TEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNI 297 ++DEDD + F + AT R TP YQI ++ Sbjct: 232 SDDEDDNNSTYLFPEIATGRRSRGVSGSSTPVHYKYQITSV 272 >At2g20950.1 68415.m02471 expressed protein Length = 520 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 419 TEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIPYQILNI 297 ++DEDD + F + AT R TP YQI ++ Sbjct: 249 SDDEDDNNSTYLFPEIATGRRSRGVSGSSTPVHYKYQITSV 289 >At1g08340.1 68414.m00922 rac GTPase activating protein, putative similar to rac GTPase activating protein 1 GI:3695059 from [Lotus japonicus]; contains Pfam profile PF00620: RhoGAP domain Length = 331 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 479 ELHEDSYEDNETIEIEVRPQTEDEDDEDE 393 E +D+ E+ E E E + EDED+E+E Sbjct: 247 EKEKDNEEEEEDEEEEEEEEDEDEDEEEE 275 >At1g07620.1 68414.m00817 GTP1/OBG family protein similar to SP|P20964 Spo0B-associated GTP-binding protein {Bacillus subtilis}; contains Pfam profile PF01018: GTP1/OBG family Length = 1016 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -1 Query: 491 NMPSELHED-SYEDNETIEIEVRPQTEDEDDEDERKPFRKYATSERQTKAQQKYTPDEIP 315 ++P L ED + E+N + E ++ D+DD ++ R+ + D+I Sbjct: 687 DLPGSLVEDPASEENSDVHQETMSES-DQDDTEQESLTRQLGMPKEADFEDDDEEIDQIR 745 Query: 314 YQILNITKQ 288 Y + +T+Q Sbjct: 746 YNVAELTQQ 754 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,556,258 Number of Sequences: 28952 Number of extensions: 298320 Number of successful extensions: 1840 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1694 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -