BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31045 (671 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23930.1 68416.m03006 expressed protein 33 0.17 At3g51010.1 68416.m05585 expressed protein 33 0.23 At5g45520.1 68418.m05591 hypothetical protein 30 1.6 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 30 1.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 1.6 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 2.1 At5g05210.1 68418.m00555 nucleolar matrix protein-related contai... 29 2.8 At5g03660.1 68418.m00325 expressed protein low similarity to out... 29 2.8 At2g25350.1 68415.m03032 phox (PX) domain-containing protein wea... 29 2.8 At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR... 29 3.7 At5g25070.1 68418.m02971 expressed protein 29 3.7 At1g01670.1 68414.m00085 U-box domain-containing protein 29 3.7 At3g43160.1 68416.m04554 expressed protein merozoite surface pro... 28 6.5 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 28 6.5 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 27 8.6 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 33.1 bits (72), Expect = 0.17 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 178 KPAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQR 297 K K + G IK +D++ + QLKE EWRK+R Sbjct: 17 KETSKDQSRGRRHLIKERDEREKVMFLQLKEAEREWRKER 56 >At3g51010.1 68416.m05585 expressed protein Length = 188 Score = 32.7 bits (71), Expect = 0.23 Identities = 22/66 (33%), Positives = 34/66 (51%) Frame = +1 Query: 448 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 627 I ++R + +KKRQA++Q K + +++K A ER +QLEEE Sbjct: 125 IGQRRAFILSEKKKRQALVQEAKRKKRIKQ---VERKMAAVARDRAWAERLIELQQLEEE 181 Query: 628 KKISLS 645 KK S+S Sbjct: 182 KKKSMS 187 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +1 Query: 445 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENF-----GLSNAQLERNKTK 609 ++E+ ++ E E++ + +++ KT P+ +K +N G SN + + +K K Sbjct: 624 NLEDGKKHDEGKEERSLKSDEVVEEEKKTSPSEEATEKFQNKPGDQKGKSNVEGDGDKGK 683 Query: 610 EQLEEEKK 633 LEEEKK Sbjct: 684 ADLEEEKK 691 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 448 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA-QLERNKTKEQLEE 624 ++ K++ KK++ + K +KTG + +KK+ + +S +++RN T E+ + Sbjct: 898 VDVKQETGSPDTKKKEGASSSSKKDTKTGEDKKAEKKNNSETMSEGKKIDRNNTDEKEVK 957 Query: 625 EKKISLSIR 651 EK I+ Sbjct: 958 EKVTEKEIK 966 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.9 bits (64), Expect = 1.6 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = +1 Query: 451 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK---EQLE 621 +EKR+R+EE E+K +KD N ++ + E SN +LE N K + + Sbjct: 112 DEKRKRMEELEEKLVVNESLIKDLQLQVLN--LKTELEEARNSNVELELNNRKLSQDLVS 169 Query: 622 EEKKI-SLSIRIKP 660 E KI SLS KP Sbjct: 170 AEAKISSLSSNDKP 183 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 187 PKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEW 285 PK+E EG+ E + + +K +++KE +EW Sbjct: 232 PKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEW 264 >At5g05210.1 68418.m00555 nucleolar matrix protein-related contains Pfam domain, PF04935: Surfeit locus protein 6 Length = 386 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/59 (20%), Positives = 33/59 (55%) Frame = +1 Query: 460 RQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKI 636 +Q + + +K+++ + K+ + F ++K+ + G ++E+NK ++ + EKK+ Sbjct: 310 KQSIHKDKKRQEKNAEKWKERIEGQQKFKVEKQQKRSGNIADRIEQNKMRKIAKREKKL 368 >At5g03660.1 68418.m00325 expressed protein low similarity to outer surface protein F [Borrelia burgdorferi] GI:466482; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 173 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 511 MKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISLSIRIK 657 +KD +F+ Q K E+ LS L K KE+ E+KK+ + R++ Sbjct: 18 LKDQLSESMSFSSQMKKEDDELSMKALSAFKAKEEEIEKKKMEIRERVQ 66 >At2g25350.1 68415.m03032 phox (PX) domain-containing protein weak similarity to SP|Q9UTK5 Abnormal long morphology protein 1 (Sp8) {Schizosaccharomyces pombe}; contains Pfam profile PF00787: PX domain Length = 643 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = +1 Query: 445 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 624 D+EE RQ+ E E K ++ D SKT N TI + E E + TK+QLE+ Sbjct: 455 DMEELRQKTFEMELKLKSKEDGSSD-SKTSGNSTISESHE------LLQEMDATKQQLED 507 Query: 625 EKKISLSIRIK 657 + + + K Sbjct: 508 LSRRYVELEAK 518 >At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1038 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +1 Query: 445 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE 594 D EKRQ L EAE+ R + S G +F + K SE F +S E Sbjct: 502 DEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSE-FSISGRAFE 550 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 28.7 bits (61), Expect = 3.7 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 454 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE-EK 630 EKR EAEKK A + K+A + + KS N Q+E K +LE+ E Sbjct: 565 EKRMPELEAEKKVAASTRNFKEAGR----IAAEAKSLNLEKDKTQMETGKANAELEKAEH 620 Query: 631 KISLSIR 651 +I +I+ Sbjct: 621 EIEETIK 627 >At1g01670.1 68414.m00085 U-box domain-containing protein Length = 365 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 6/73 (8%) Frame = +1 Query: 451 EEKRQRLEEAEKKRQ-----AMLQAMKDASKTGPNFT-IQKKSENFGLSNAQLERNKTKE 612 EE+R+RLE E KR+ M + ++A + T I E + E N+ K Sbjct: 177 EEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVMRRREVEAELNRAKA 236 Query: 613 QLEEEKKISLSIR 651 ++E+ K++ + ++ Sbjct: 237 EIEDMKRVQIELK 249 >At3g43160.1 68416.m04554 expressed protein merozoite surface protein 2 (MSP-2), EMBL:PFU72951, Plasmodium falciparum Length = 295 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 218 SSSVKTRSGRTWMNS*RNTSTNGANSGPRRRMSSNALKRSR 340 +S+ +TRSGR +++ +ST NS R SS K R Sbjct: 103 NSTTRTRSGRGFIDYVLESSTGTENSSTRTAESSTRTKNGR 143 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +1 Query: 448 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKT---KEQL 618 +E+K + LEE +K + A+ A + G +IQ + +S + N++ +L Sbjct: 155 LEQKLKSLEELSEKVSELKSALIVAEEEGKKSSIQMQEYQEKVSKLESSLNQSSARNSEL 214 Query: 619 EEEKKISL 642 EE+ +I+L Sbjct: 215 EEDLRIAL 222 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 27.5 bits (58), Expect = 8.6 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 454 EKRQRLEE-AEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQL---E 621 E+R++ EE A K+ +A + ++A + T +KK E + ER + +E+ E Sbjct: 444 ERRRKEEEEARKREEAKRREEEEAKRREEEETERKKREEEEARKREEERKREEEEAKRRE 503 Query: 622 EEKK 633 EE+K Sbjct: 504 EERK 507 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/61 (18%), Positives = 32/61 (52%) Frame = +1 Query: 451 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEK 630 EE+++ EEA+++ + + ++A + ++K E + + K +E++E ++ Sbjct: 490 EERKREEEEAKRREEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKR 549 Query: 631 K 633 + Sbjct: 550 R 550 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.130 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,892,893 Number of Sequences: 28952 Number of extensions: 144603 Number of successful extensions: 654 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -