BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31044 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 4.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 6.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.5 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 1.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -1 Query: 172 LVLSSLWFKLPWN 134 L++++LW KL WN Sbjct: 69 LLITNLWLKLEWN 81 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/46 (23%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 148 KLPWNANSVILGTS*TDIRS-PFGRKACIFTSGI*AYDIFINKIRH 14 ++ W ++ + D+ PF + C+ G YD F +RH Sbjct: 136 RVEWKPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRH 181 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 474 WQIEQYIPIYHP 509 + IE+Y+ IYHP Sbjct: 128 FSIERYLAIYHP 139 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 88 PFGRKACIFTSGI*AYDIFINKIRH 14 PF + C+ G YD F +RH Sbjct: 161 PFDEQTCVLKFGSWTYDGFKVDLRH 185 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 454 IPWTKTFGKSSSIYRFITPN 513 IP + G S+S RFI PN Sbjct: 372 IPRFRHIGPSTSFPRFIPPN 391 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 164 QHQRRDTECRGTGSSQRPMGVRRAR 238 QHQ R+ E G G ++ G +R Sbjct: 1233 QHQAREREGVGAGIAETSAGTSNSR 1257 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,624 Number of Sequences: 438 Number of extensions: 4393 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -