BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31041 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 89 2e-18 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 89 2e-18 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 87 5e-18 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 87 5e-18 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 87 6e-18 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 87 6e-18 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 86 1e-17 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 85 3e-17 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 72 2e-13 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 55 3e-08 12_02_1282 + 27528159-27529148,27529549-27529614 48 3e-06 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 48 3e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 40 0.001 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 36 0.011 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 35 0.026 01_06_1783 + 39845998-39846174,39846260-39846534,39846758-398468... 29 1.7 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 28 3.9 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 27 6.9 04_04_1136 - 31142742-31142806,31143245-31143325,31143432-311435... 27 9.1 03_06_0429 - 33863848-33864237,33864396-33864506,33864857-338649... 27 9.1 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 88.6 bits (210), Expect = 2e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 337 RKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 88.6 bits (210), Expect = 2e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 337 RKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 340 RKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK EYDESGPGIVH KCF Sbjct: 336 RKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 87.0 bits (206), Expect = 6e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK EYDESGPGIVH KCF Sbjct: 336 RKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 87.0 bits (206), Expect = 6e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 334 RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 86.2 bits (204), Expect = 1e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 337 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 84.6 bits (200), Expect = 3e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWIS+ EY+ESGP IVHRKCF Sbjct: 337 RKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 72.1 bits (169), Expect = 2e-13 Identities = 38/55 (69%), Positives = 39/55 (70%), Gaps = 14/55 (25%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQ--------------MWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQ MWISK EYDESGP IVHRKCF Sbjct: 337 RKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 54.8 bits (126), Expect = 3e-08 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +1 Query: 7 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +YS W+GG+ILA + Q ++K +YDE+GP IVH+KCF Sbjct: 359 RYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +1 Query: 37 LASLSTFQQMWISKEEYDESGPGIVHRKCF 126 LA S +MWI+K EYDESGP IVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 48.0 bits (109), Expect = 3e-06 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEE 84 +++SVWIGGSILASL +FQQMW SK + Sbjct: 443 RRFSVWIGGSILASLGSFQQMWFSKAD 469 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 108 ++Y+VW GGS+LAS + F + +K EY+E G I Sbjct: 428 QRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 36.3 bits (80), Expect = 0.011 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 108 + Y+ W GGS+ AS F + +KEEY+E G I Sbjct: 395 QSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 35.1 bits (77), Expect = 0.026 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 19 WIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 W GGS+LA F+ M I+K EY+E G R+ F Sbjct: 393 WRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >01_06_1783 + 39845998-39846174,39846260-39846534,39846758-39846891, 39846992-39847116,39847312-39847494,39847610-39847644, 39847756-39847912,39847936-39848049,39848143-39848235, 39848316-39848455,39848606-39848676,39848759-39848839, 39851475-39851954,39852110-39852387,39853346-39854143 Length = 1046 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = -1 Query: 150 GVTRPRCLEALAVDDAGAGLVVFLLRDPHLLEGGQ----GSQDGSTDPYGVLLR 1 G++ CL ALA + G+ + P EGG GS G T P V++R Sbjct: 893 GISVETCLTALATNPNFTGIAIVRTYSPDHYEGGAWNTGGSCTGKTKPLDVVVR 946 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 5/39 (12%) Frame = +1 Query: 13 SVWIGGSILASLSTFQQMW-ISKEEYDE----SGPGIVH 114 S W G +++++STF + W I K+++ + +GP V+ Sbjct: 444 SAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 19 WIGGSILASLSTFQQMWISKEEYDESGPGIVHRK 120 W G + A+ S F + S +Y E G + HRK Sbjct: 669 WRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 >04_04_1136 - 31142742-31142806,31143245-31143325,31143432-31143588, 31143695-31143809,31144016-31144083,31144171-31144314, 31144393-31144470,31144555-31144637,31144729-31144768, 31144993-31145067,31145202-31145314,31145839-31145878, 31145977-31146128,31146351-31146405,31146717-31146776, 31147005-31147268,31148379-31148436,31148606-31148637 Length = 559 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 63 LLEGGQGSQDGSTDPYG 13 LL GGQG++ GS+DP G Sbjct: 202 LLAGGQGTRLGSSDPKG 218 >03_06_0429 - 33863848-33864237,33864396-33864506,33864857-33864904, 33865666-33865785 Length = 222 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 120 LAVDDAGAGLVVFLLRDPHLLEGGQGSQDGSTD 22 L +DD+ A V DP+ GG+ QDG+T+ Sbjct: 107 LKIDDSSAAEVD--ANDPYTQSGGKNKQDGNTN 137 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,781,769 Number of Sequences: 37544 Number of extensions: 209409 Number of successful extensions: 454 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -