BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31041 (447 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 89 9e-20 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 89 9e-20 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 89 9e-20 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 86 5e-19 Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. 23 3.7 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 6.5 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 22 8.6 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 88.6 bits (210), Expect = 9e-20 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 336 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 88.6 bits (210), Expect = 9e-20 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 336 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 88.6 bits (210), Expect = 9e-20 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 336 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 86.2 bits (204), Expect = 5e-19 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +1 Query: 4 KKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 126 +KYSVWIGGSILASLSTFQ MWISK EYDE GPGIVHRKCF Sbjct: 336 RKYSVWIGGSILASLSTFQTMWISKHEYDEGGPGIVHRKCF 376 >Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. Length = 124 Score = 23.4 bits (48), Expect = 3.7 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 196 DGCVQNSDEHNTTQHRGHAAAL 131 +GCV++ +EH G+ A+L Sbjct: 33 EGCVRSREEHARAGQEGNVASL 54 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 22.6 bits (46), Expect = 6.5 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +2 Query: 128 KQRGRVTPVLCGVVLVRVLNATVSTLYLVIPEN*TSNLTPSILM*FIVKFYINLI 292 + R R + C VV + V NA S +L I TP L I ++ N + Sbjct: 533 RSRNRYSGRYCAVVTLDVTNAFNSASWLAIANALQRINTPKYLYDIIGDYFRNRV 587 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 22.2 bits (45), Expect = 8.6 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -1 Query: 216 ITRYNVLTVAFRTRTSTTPHSTGVTRPRCLEALAVDDAG 100 +TR T T+TT T T P C L + G Sbjct: 114 VTRTKATVAPKSTTTTTTVKPTTTTPPPCPPTLTTFNGG 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,421 Number of Sequences: 2352 Number of extensions: 7673 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -