Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31036
         (322 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ...    31   3.7  
UniRef50_Q7RJH9 Cluster: Putative uncharacterized protein PY0328...    30   8.6  

>UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 275

 Score = 31.5 bits (68), Expect = 3.7
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +2

Query: 284 GGARYPIRPIVSR 322
           GGARYPIRPIVSR
Sbjct: 261 GGARYPIRPIVSR 273


>UniRef50_Q7RJH9 Cluster: Putative uncharacterized protein PY03281;
           n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY03281 - Plasmodium yoelii yoelii
          Length = 764

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = -3

Query: 173 GPRRGPVASYSFVTN-PLTYCYYNMNKIFLLFILFHETSLTAYDDTIN 33
           GPR+ P+ +Y+  +   L     N   IF+     H  S  AYDD IN
Sbjct: 28  GPRKWPIINYNKNSILKLMKLLNNKRNIFISIEFCHNNSYEAYDDIIN 75


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 235,873,760
Number of Sequences: 1657284
Number of extensions: 2894523
Number of successful extensions: 6763
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6673
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6762
length of database: 575,637,011
effective HSP length: 83
effective length of database: 438,082,439
effective search space used: 10075896097
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)