BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31036 (322 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ923614-1|ABI95804.1| 2765|Drosophila melanogaster DUNC79 protein. 27 7.1 AY047496-1|AAK77228.1| 638|Drosophila melanogaster GH01039p pro... 27 7.1 AE014297-2646|AAF55654.2| 2958|Drosophila melanogaster CG5237-PA... 27 7.1 BT022938-1|AAY55354.1| 271|Drosophila melanogaster IP08405p pro... 26 9.4 AE014296-2149|AAN11869.2| 310|Drosophila melanogaster CG10638-P... 26 9.4 >DQ923614-1|ABI95804.1| 2765|Drosophila melanogaster DUNC79 protein. Length = 2765 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 107 YNSNKLMDWLQNCRTRPARVEGPISGASDFY 199 Y S L+ WLQ + + ++E S A+ FY Sbjct: 2733 YKSEALLKWLQRLQFKMGQIELQASTATQFY 2763 >AY047496-1|AAK77228.1| 638|Drosophila melanogaster GH01039p protein. Length = 638 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 107 YNSNKLMDWLQNCRTRPARVEGPISGASDFY 199 Y S L+ WLQ + + ++E S A+ FY Sbjct: 606 YKSEALLKWLQRLQFKMGQIELQASTATQFY 636 >AE014297-2646|AAF55654.2| 2958|Drosophila melanogaster CG5237-PA protein. Length = 2958 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 107 YNSNKLMDWLQNCRTRPARVEGPISGASDFY 199 Y S L+ WLQ + + ++E S A+ FY Sbjct: 2926 YKSEALLKWLQRLQFKMGQIELQASTATQFY 2956 >BT022938-1|AAY55354.1| 271|Drosophila melanogaster IP08405p protein. Length = 271 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 101 SYYNSNKLMDWLQNCRTRPARVE 169 S +N+N+L L+NC+ +PA ++ Sbjct: 124 SNFNANQLKRLLENCQIKPANLQ 146 >AE014296-2149|AAN11869.2| 310|Drosophila melanogaster CG10638-PB, isoform B protein. Length = 310 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 101 SYYNSNKLMDWLQNCRTRPARVE 169 S +N+N+L L+NC+ +PA ++ Sbjct: 163 SNFNANQLKRLLENCQIKPANLQ 185 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,119,611 Number of Sequences: 53049 Number of extensions: 121635 Number of successful extensions: 275 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 674007744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -