BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31033 (781 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 37 0.49 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 36 1.5 UniRef50_Q1IKI4 Cluster: TPR repeat protein precursor; n=1; Acid... 34 3.5 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 37.1 bits (82), Expect = 0.49 Identities = 21/47 (44%), Positives = 25/47 (53%) Frame = +1 Query: 451 NPQTQPTEFFAGSSQRVTFPIRW*ILRSAALTRASLSNFLRLEPREL 591 NP+TQP +F AGSSQ F + L L+N LRL P EL Sbjct: 69 NPKTQPMKFLAGSSQSSRFRSDGRFCEALLLLGLVLANSLRLSPYEL 115 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 458 RHSPLSFLPDLLNGSRFRSGGRF 526 R PLSF PDLL+GSRFR+G + Sbjct: 393 RCCPLSFSPDLLSGSRFRTGAEY 415 >UniRef50_Q1IKI4 Cluster: TPR repeat protein precursor; n=1; Acidobacteria bacterium Ellin345|Rep: TPR repeat protein precursor - Acidobacteria bacterium (strain Ellin345) Length = 353 Score = 34.3 bits (75), Expect = 3.5 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = +1 Query: 403 FNFIFIYHGNYLSICLNPQTQPTEFFAGSSQRVTFPIRW*ILRSAALTRASLSNFLRLEP 582 F+F + G+Y + ++ + E F SQ V+ +R + RSAA TR ++S P Sbjct: 83 FDFANLRPGSYEVVAIDGVMEAREQFIVQSQLVSLSLRMPVTRSAAPTRGTISVAELKVP 142 Query: 583 RELIYSLDYA-SIFSKGYQLR*EKK 654 + + LD A SKG+ EK+ Sbjct: 143 DKAKHLLDKAQGALSKGHSDEAEKQ 167 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,887,584 Number of Sequences: 1657284 Number of extensions: 11874301 Number of successful extensions: 23675 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23672 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65850543200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -