BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31033 (781 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81536-4|CAB04364.1| 310|Caenorhabditis elegans Hypothetical pr... 30 2.1 AC024800-2|AAF60723.2| 320|Caenorhabditis elegans Serpentine re... 29 3.7 AC024800-1|AAF60725.1| 320|Caenorhabditis elegans Serpentine re... 29 3.7 >Z81536-4|CAB04364.1| 310|Caenorhabditis elegans Hypothetical protein F40D4.5 protein. Length = 310 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 333 LQSVHSYFECVFLSTYVFCLVNT*PGREISFDAVKLT*KLNVLF 202 L+S SY +CV +++ CL+ P + F ++L K NV F Sbjct: 40 LRSKSSYLQCVLSVSHIICLLFEIPNAALLFTGIRL--KRNVCF 81 >AC024800-2|AAF60723.2| 320|Caenorhabditis elegans Serpentine receptor, class h protein305 protein. Length = 320 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 204 FIHNPNQSDARTFYFSKIPKSQHKDFTNRCYI 109 +IHN +Q + R F F KIP + F ++ Y+ Sbjct: 164 YIHNSDQVELRKFAFKKIPCPTIEFFDSKTYV 195 >AC024800-1|AAF60725.1| 320|Caenorhabditis elegans Serpentine receptor, class h protein57 protein. Length = 320 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 204 FIHNPNQSDARTFYFSKIPKSQHKDFTNRCYI 109 +IHN +Q + R F F KIP + F ++ Y+ Sbjct: 164 YIHNSDQVELRKFAFKKIPCPTIEFFDSKTYV 195 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,245,108 Number of Sequences: 27780 Number of extensions: 314791 Number of successful extensions: 686 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -