BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31032 (603 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29510.1 68415.m03584 expressed protein 27 7.2 At1g73990.1 68414.m08569 peptidase U7 family protein similar to ... 27 9.6 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 27 9.6 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 27 9.6 >At2g29510.1 68415.m03584 expressed protein Length = 839 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 358 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVS 480 +C+ PR+R + P+RSRTL ++ + + S A +S Sbjct: 362 SCSAPRSRKAESSPSRSRTLDRRSTETLPKQSDQKPAKVLS 402 >At1g73990.1 68414.m08569 peptidase U7 family protein similar to protease IV GB:AAA57008 from [Escherichia coli]; contains Pfam profile PF01343: Peptidase family U7 Length = 677 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +3 Query: 315 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVG 467 +I +DVA G +Y+ N I+AE ++G + YE +G Sbjct: 450 VIASMSDVAASGGYYMAMAANAIVAENLTLTGSIGVVTARFTLAKLYEKIG 500 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 369 TENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 494 TE ++L E+ K+E + E EG+K E D T + D Sbjct: 966 TETQVLVEDTQKIEALTEEVEGLKANLEQEKQRADDATRKFD 1007 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 27.1 bits (57), Expect = 9.6 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -2 Query: 275 HLAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKVFAEVL 129 H G CG H G GC G G G G + G + S V A L Sbjct: 781 HHGGGGCGGGHHGGGGGGCGGCGGGGC--GGGGDGGGMTSRAVVAASTL 827 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,208,095 Number of Sequences: 28952 Number of extensions: 163565 Number of successful extensions: 529 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -