BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31031 (378 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z29117-6|CAA82378.1| 176|Caenorhabditis elegans Hypothetical pr... 29 1.5 U80836-15|AAB37898.1| 264|Caenorhabditis elegans Hypothetical p... 27 4.5 U23511-5|AAC46794.1| 578|Caenorhabditis elegans Hypothetical pr... 27 5.9 AL021480-1|CAA16326.1| 133|Caenorhabditis elegans Hypothetical ... 27 5.9 Z81470-7|CAB03885.1| 129|Caenorhabditis elegans Hypothetical pr... 26 7.8 AC024842-3|AAP13732.1| 1111|Caenorhabditis elegans Hypothetical ... 26 7.8 AC024842-1|AAF59622.4| 1127|Caenorhabditis elegans Hypothetical ... 26 7.8 >Z29117-6|CAA82378.1| 176|Caenorhabditis elegans Hypothetical protein C48B4.6 protein. Length = 176 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 275 CQYHMAYLCNFFFIPLLFSKHGTYDFFPY 189 C YHM Y +FF+ +L + H + F + Sbjct: 40 CYYHMFYSRQYFFLEILVTIHTGFSFIVF 68 >U80836-15|AAB37898.1| 264|Caenorhabditis elegans Hypothetical protein B0432.1 protein. Length = 264 Score = 27.1 bits (57), Expect = 4.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 124 YINIIFVTYYVCLYSLTFVKYV 59 YI I V + +CL+ +TF KYV Sbjct: 66 YIGIADVLHCICLFWMTFQKYV 87 >U23511-5|AAC46794.1| 578|Caenorhabditis elegans Hypothetical protein C32D5.6 protein. Length = 578 Score = 26.6 bits (56), Expect = 5.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 8 NSVIKYIAYFLYLLTKFDVFYKSERIQTNIICDKDYINILPKRYC 142 NS++ F+Y FD+F K+ ++ I+ D D + + K C Sbjct: 431 NSLLFAHYEFIYFWNGFDIFGKNSKMVRGIVEDMDRVWEMKKSTC 475 >AL021480-1|CAA16326.1| 133|Caenorhabditis elegans Hypothetical protein Y39E4A.1 protein. Length = 133 Score = 26.6 bits (56), Expect = 5.9 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -3 Query: 304 LSNRQVIYYRVNIIWPICVIFFL 236 L N +++Y+ + IW IC++ F+ Sbjct: 102 LKNAKIVYWTMLGIWTICLVLFV 124 >Z81470-7|CAB03885.1| 129|Caenorhabditis elegans Hypothetical protein C14A6.8 protein. Length = 129 Score = 26.2 bits (55), Expect = 7.8 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 355 LSSLHGNKKDXLIFAIVLSNRQVIYYRVNIIWPICVIFFLYHCYFQNMGRTIF 197 L GNK + N ++ ++ + IW IC+ FF+ Y G IF Sbjct: 76 LKKPRGNKAKIKKLKNKIKNVKIFFWTMIGIWVICLCFFVL-IYLNTYGIRIF 127 >AC024842-3|AAP13732.1| 1111|Caenorhabditis elegans Hypothetical protein Y59H11AR.2b protein. Length = 1111 Score = 26.2 bits (55), Expect = 7.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 14 VIKYIAYFLYLLTKFDVFYKSERIQTNIICDKDYINIL 127 V+ +A+F ++ T F +FY+ I II D + I+ Sbjct: 399 VLAIVAFFGFMYTSFILFYRGSSIGKIIIRALDLVTIV 436 >AC024842-1|AAF59622.4| 1127|Caenorhabditis elegans Hypothetical protein Y59H11AR.2a protein. Length = 1127 Score = 26.2 bits (55), Expect = 7.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 14 VIKYIAYFLYLLTKFDVFYKSERIQTNIICDKDYINIL 127 V+ +A+F ++ T F +FY+ I II D + I+ Sbjct: 415 VLAIVAFFGFMYTSFILFYRGSSIGKIIIRALDLVTIV 452 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,268,733 Number of Sequences: 27780 Number of extensions: 153303 Number of successful extensions: 299 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 557037416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -