BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31030 (743 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6P936 Cluster: Secretion protein HlyD family protein; ... 34 3.2 UniRef50_Q9LJ76 Cluster: En/Spm transposon protein-like; n=1; Ar... 34 4.2 >UniRef50_A6P936 Cluster: Secretion protein HlyD family protein; n=2; Alteromonadales|Rep: Secretion protein HlyD family protein - Shewanella sediminis HAW-EB3 Length = 378 Score = 34.3 bits (75), Expect = 3.2 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = -1 Query: 164 GRAVVPTRADSHEVLP*FDQSI*LLTEILTAHFHLFSVVTKDTLRFLG 21 GRA+V D H+V F + I T HFH SV+ K LR G Sbjct: 324 GRAIVLIELDDHDVKSAFPAGVAGQAAIYTEHFHHVSVIRKVLLRMQG 371 >UniRef50_Q9LJ76 Cluster: En/Spm transposon protein-like; n=1; Arabidopsis thaliana|Rep: En/Spm transposon protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 818 Score = 33.9 bits (74), Expect = 4.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 217 TAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNL 110 T LP + K++ SR+ + PWY+ +R R YH L Sbjct: 357 TYILPSQAKQVFYSREDESSPWYVVMRAPPRGYHEL 392 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,128,612 Number of Sequences: 1657284 Number of extensions: 12320063 Number of successful extensions: 20207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20205 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -