BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31030 (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.99 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.99 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.3 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 7.0 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 22 7.0 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 9.2 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.99 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 219 QRLPYPSDRNALL-LHGRNRQGRGTYPCGLTR 127 ++LP ++ LL L+G NR+ RG Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.99 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 219 QRLPYPSDRNALL-LHGRNRQGRGTYPCGLTR 127 ++LP ++ LL L+G NR+ RG Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -2 Query: 700 REIDFETSYQLTTTNIKGLSGQVEKG--SNLQL 608 ++ID+E L +++GL+G G NLQL Sbjct: 300 KDIDYENVQSLYQPHLRGLNGLEFAGRPQNLQL 332 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 21.8 bits (44), Expect = 7.0 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +2 Query: 635 LSRKSLYVRSRELIRCF 685 +S ++Y+R +L++CF Sbjct: 107 ISDANIYIRFNKLVKCF 123 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 21.8 bits (44), Expect = 7.0 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +2 Query: 635 LSRKSLYVRSRELIRCF 685 +S ++Y+R +L++CF Sbjct: 107 ISDANIYIRFNKLVKCF 123 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 590 TCPLFMKIHFTNI*NSIERFYSQ*FGYYTFETD 492 TC IH N+ NS++ Y + Y F +D Sbjct: 13 TCQGVTDIHSRNLTNSLKVIYEWKYIDYDFGSD 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,674 Number of Sequences: 438 Number of extensions: 3810 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -