BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31025 (769 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0800 - 7047425-7048253,7048340-7048927,7049050-7049268,704... 29 5.4 10_07_0057 + 12460986-12461036,12461108-12461161,12461420-124614... 29 5.4 06_01_1082 - 8847795-8848033,8848511-8848724 28 9.4 >11_01_0800 - 7047425-7048253,7048340-7048927,7049050-7049268, 7049398-7049518,7050593-7050983 Length = 715 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = +2 Query: 131 NCTTASSPVTTTVLYVRAWNTRAKARAASFKM*LTI*SLTRDGTPWSTATSCGSATD--- 301 +C TAS +L+ K R + I + R W+ SCG+ D Sbjct: 579 DCATASDTTQIKLLFGAKGAVHIKGRCIGGERRFAIYRMERGVDKWTVKCSCGATDDDGE 638 Query: 302 RILSKSTSH 328 R+LS T H Sbjct: 639 RMLSCDTCH 647 >10_07_0057 + 12460986-12461036,12461108-12461161,12461420-12461482, 12461666-12461716,12461996-12462057,12462156-12462318, 12462829-12462939,12463029-12463166,12463248-12463322, 12463420-12463540,12464827-12464981,12465080-12465154, 12465270-12465473,12465670-12465786 Length = 479 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -3 Query: 347 MMSLKLNGKYFLTISCPLPTHSL*QYSMVFRLLSMI 240 MM L + GK I CP+P+HSL SMV R +++ Sbjct: 152 MMHLLIRGKKD-GILCPIPSHSLYTDSMVLRGATLV 186 >06_01_1082 - 8847795-8848033,8848511-8848724 Length = 150 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 583 ARDRVVYGGNSADSTR--EQWFFQPAKYENDVLFFIYNREFND 705 A + Y G++A R + W Y DVL F YN+E++D Sbjct: 39 AGGKTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHD 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,832,385 Number of Sequences: 37544 Number of extensions: 405531 Number of successful extensions: 1289 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1289 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -