BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31023 (343 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY603755-1|AAT80901.1| 3094|Homo sapiens striated muscle prefere... 28 8.7 AB037718-1|BAA92535.1| 2242|Homo sapiens KIAA1297 protein protein. 28 8.7 >AY603755-1|AAT80901.1| 3094|Homo sapiens striated muscle preferentially expressed protein protein. Length = 3094 Score = 27.9 bits (59), Expect = 8.7 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 37 AICLSLTVALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSR--DNSGRYIP 210 +I S TVA+A GK P + + Y + ++KPG A P Y R D + P Sbjct: 2536 SITSSCTVAVARVPGKLAPPEVTQTYQDTALVLWKPGDSRA-PCTYTLERRVDGESVWHP 2594 Query: 211 DNSG 222 +SG Sbjct: 2595 VSSG 2598 >AB037718-1|BAA92535.1| 2242|Homo sapiens KIAA1297 protein protein. Length = 2242 Score = 27.9 bits (59), Expect = 8.7 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 37 AICLSLTVALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSR--DNSGRYIP 210 +I S TVA+A GK P + + Y + ++KPG A P Y R D + P Sbjct: 1684 SITSSCTVAVARVPGKLAPPEVTQTYQDTALVLWKPGDSRA-PCTYTLERRVDGESVWHP 1742 Query: 211 DNSG 222 +SG Sbjct: 1743 VSSG 1746 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,446,404 Number of Sequences: 237096 Number of extensions: 609875 Number of successful extensions: 2396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2396 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1910415606 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -