BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31021 (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51010.1 68416.m05585 expressed protein 33 0.23 At3g23930.1 68416.m03006 expressed protein 32 0.41 At5g45520.1 68418.m05591 hypothetical protein 30 1.7 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 30 1.7 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 1.7 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 2.2 At5g05210.1 68418.m00555 nucleolar matrix protein-related contai... 29 2.9 At5g03660.1 68418.m00325 expressed protein low similarity to out... 29 2.9 At2g25350.1 68415.m03032 phox (PX) domain-containing protein wea... 29 2.9 At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR... 29 3.8 At5g25070.1 68418.m02971 expressed protein 29 3.8 At1g01670.1 68414.m00085 U-box domain-containing protein 29 3.8 At5g08600.1 68418.m01023 U3 ribonucleoprotein (Utp) family prote... 28 6.7 At5g08080.1 68418.m00942 syntaxin, putative (SYP132) similar to ... 28 6.7 At3g43160.1 68416.m04554 expressed protein merozoite surface pro... 28 6.7 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 28 6.7 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 27 8.8 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 27 8.8 >At3g51010.1 68416.m05585 expressed protein Length = 188 Score = 32.7 bits (71), Expect = 0.23 Identities = 22/66 (33%), Positives = 34/66 (51%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 621 I ++R + +KKRQA++Q K + +++K A ER +QLEEE Sbjct: 125 IGQRRAFILSEKKKRQALVQEAKRKKRIKQ---VERKMAAVARDRAWAERLIELQQLEEE 181 Query: 622 KKISLS 639 KK S+S Sbjct: 182 KKKSMS 187 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 184 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQR 291 K + G IK +D++ + QLKE EWRK+R Sbjct: 21 KDQSRGRRHLIKERDEREKVMFLQLKEAEREWRKER 56 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +1 Query: 439 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENF-----GLSNAQLERNKTK 603 ++E+ ++ E E++ + +++ KT P+ +K +N G SN + + +K K Sbjct: 624 NLEDGKKHDEGKEERSLKSDEVVEEEKKTSPSEEATEKFQNKPGDQKGKSNVEGDGDKGK 683 Query: 604 EQLEEEKK 627 LEEEKK Sbjct: 684 ADLEEEKK 691 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA-QLERNKTKEQLEE 618 ++ K++ KK++ + K +KTG + +KK+ + +S +++RN T E+ + Sbjct: 898 VDVKQETGSPDTKKKEGASSSSKKDTKTGEDKKAEKKNNSETMSEGKKIDRNNTDEKEVK 957 Query: 619 EKKISLSIR 645 EK I+ Sbjct: 958 EKVTEKEIK 966 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.9 bits (64), Expect = 1.7 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = +1 Query: 445 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK---EQLE 615 +EKR+R+EE E+K +KD N ++ + E SN +LE N K + + Sbjct: 112 DEKRKRMEELEEKLVVNESLIKDLQLQVLN--LKTELEEARNSNVELELNNRKLSQDLVS 169 Query: 616 EEKKI-SLSIRIKP 654 E KI SLS KP Sbjct: 170 AEAKISSLSSNDKP 183 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 181 PKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEW 279 PK+E EG+ E + + +K +++KE +EW Sbjct: 232 PKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEW 264 >At5g05210.1 68418.m00555 nucleolar matrix protein-related contains Pfam domain, PF04935: Surfeit locus protein 6 Length = 386 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/59 (20%), Positives = 33/59 (55%) Frame = +1 Query: 454 RQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKI 630 +Q + + +K+++ + K+ + F ++K+ + G ++E+NK ++ + EKK+ Sbjct: 310 KQSIHKDKKRQEKNAEKWKERIEGQQKFKVEKQQKRSGNIADRIEQNKMRKIAKREKKL 368 >At5g03660.1 68418.m00325 expressed protein low similarity to outer surface protein F [Borrelia burgdorferi] GI:466482; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 173 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 505 MKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISLSIRIK 651 +KD +F+ Q K E+ LS L K KE+ E+KK+ + R++ Sbjct: 18 LKDQLSESMSFSSQMKKEDDELSMKALSAFKAKEEEIEKKKMEIRERVQ 66 >At2g25350.1 68415.m03032 phox (PX) domain-containing protein weak similarity to SP|Q9UTK5 Abnormal long morphology protein 1 (Sp8) {Schizosaccharomyces pombe}; contains Pfam profile PF00787: PX domain Length = 643 Score = 29.1 bits (62), Expect = 2.9 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = +1 Query: 439 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 618 D+EE RQ+ E E K ++ D SKT N TI + E E + TK+QLE+ Sbjct: 455 DMEELRQKTFEMELKLKSKEDGSSD-SKTSGNSTISESHE------LLQEMDATKQQLED 507 Query: 619 EKKISLSIRIK 651 + + + K Sbjct: 508 LSRRYVELEAK 518 >At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1038 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +1 Query: 439 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE 588 D EKRQ L EAE+ R + S G +F + K SE F +S E Sbjct: 502 DEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSE-FSISGRAFE 550 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 448 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE-EK 624 EKR EAEKK A + K+A + + KS N Q+E K +LE+ E Sbjct: 565 EKRMPELEAEKKVAASTRNFKEAGR----IAAEAKSLNLEKDKTQMETGKANAELEKAEH 620 Query: 625 KISLSIR 645 +I +I+ Sbjct: 621 EIEETIK 627 >At1g01670.1 68414.m00085 U-box domain-containing protein Length = 365 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 6/73 (8%) Frame = +1 Query: 445 EEKRQRLEEAEKKRQ-----AMLQAMKDASKTGPNFT-IQKKSENFGLSNAQLERNKTKE 606 EE+R+RLE E KR+ M + ++A + T I E + E N+ K Sbjct: 177 EEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVMRRREVEAELNRAKA 236 Query: 607 QLEEEKKISLSIR 645 ++E+ K++ + ++ Sbjct: 237 EIEDMKRVQIELK 249 >At5g08600.1 68418.m01023 U3 ribonucleoprotein (Utp) family protein contains Pfam profile: PF04615 Utp14 protein Length = 822 Score = 27.9 bits (59), Expect = 6.7 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +1 Query: 466 EEAEKKRQAMLQAMKDASKTGPNFT--IQKKSENFGLSNAQLERNKTKEQLEEEKKISLS 639 EEA+K R+ L+ KDAS + + KK+E + +KE E+ ++ + Sbjct: 710 EEAKKTREQALRKRKDASFKHVIISEKVDKKAEKLQTKSLPYPYT-SKEVFEQSMRMPIG 768 Query: 640 IRIKPLTIEGL 672 P TI G+ Sbjct: 769 PEFNPTTIVGV 779 >At5g08080.1 68418.m00942 syntaxin, putative (SYP132) similar to SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} Length = 304 Score = 27.9 bits (59), Expect = 6.7 Identities = 23/81 (28%), Positives = 39/81 (48%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 621 I+++ +L++ KK QA + K +K I+K E + R K +LEE Sbjct: 44 IDKQYDKLDKLLKKLQASHEESKSVTKAPAMKAIKKTMEKDVDEVGSIARF-IKGKLEEL 102 Query: 622 KKISLSIRIKPLTIEGLSVDK 684 + +L+ R KP +G VD+ Sbjct: 103 DRENLANRQKPGCAKGSGVDR 123 >At3g43160.1 68416.m04554 expressed protein merozoite surface protein 2 (MSP-2), EMBL:PFU72951, Plasmodium falciparum Length = 295 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 212 SSSVKTRSGRTWMNS*RNTSTNGANSGPRRRMSSNALKRSR 334 +S+ +TRSGR +++ +ST NS R SS K R Sbjct: 103 NSTTRTRSGRGFIDYVLESSTGTENSSTRTAESSTRTKNGR 143 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKT---KEQL 612 +E+K + LEE +K + A+ A + G +IQ + +S + N++ +L Sbjct: 155 LEQKLKSLEELSEKVSELKSALIVAEEEGKKSSIQMQEYQEKVSKLESSLNQSSARNSEL 214 Query: 613 EEEKKISL 636 EE+ +I+L Sbjct: 215 EEDLRIAL 222 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 448 EKRQRLEE-AEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQL---E 615 E+R++ EE A K+ +A + ++A + T +KK E + ER + +E+ E Sbjct: 444 ERRRKEEEEARKREEAKRREEEEAKRREEEETERKKREEEEARKREEERKREEEEAKRRE 503 Query: 616 EEKK 627 EE+K Sbjct: 504 EERK 507 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/61 (18%), Positives = 32/61 (52%) Frame = +1 Query: 445 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEK 624 EE+++ EEA+++ + + ++A + ++K E + + K +E++E ++ Sbjct: 490 EERKREEEEAKRREEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKR 549 Query: 625 K 627 + Sbjct: 550 R 550 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 27.5 bits (58), Expect = 8.8 Identities = 21/80 (26%), Positives = 36/80 (45%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 621 + E ++L + + ML+ + + S N QK+ E +N E KE++E Sbjct: 684 LHELSEKLSFKTSQMERMLENLDEKSNEIDN---QKRHEEDVTANLNQEIKILKEEIENL 740 Query: 622 KKISLSIRIKPLTIEGLSVD 681 KK S+ ++ E L VD Sbjct: 741 KKNQDSLMLQAEQAENLRVD 760 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,395,479 Number of Sequences: 28952 Number of extensions: 159636 Number of successful extensions: 656 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -