BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31019 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.52 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 1.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 1.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 1.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 1.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 1.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 1.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 1.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 1.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.7 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 23 3.7 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 23 3.7 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 23 3.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.4 bits (53), Expect = 0.52 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +2 Query: 236 TSRDCSNLIKWISNSPLGKWFTCSLPLRKYSETLTIG 346 T +DC + W S +P TC +Y +G Sbjct: 92 TGKDCGEYVDWCSTNPCENQATCVQNKNQYQCLCGVG 128 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 79 PRSTPPLSTPSNSNATKSS 97 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 157 PRSTSPLPAPANYQPTTAS 213 PRST PL P+N T +S Sbjct: 123 PRSTPPLSTPSNSNATKSS 141 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 528 CGDQYSCSDEINEHHKQH 475 CG +++ SDE+ H + H Sbjct: 352 CGKRFTRSDELQRHLRTH 369 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 124 STSPTPNLHNYPRSTSPLPAPANYQP 201 ST+ P N+P + +P PA P Sbjct: 1069 STTTRPTTTNWPTQGTTIPPPAVVMP 1094 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = +1 Query: 622 FFPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYIS 759 FF +S H F ++ +N +++ L W+ + ++ M +S Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVFVMLLS 238 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = +1 Query: 622 FFPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYIS 759 FF +S H F ++ +N +++ L W+ + ++ M +S Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVFVMLLS 238 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = +1 Query: 622 FFPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYIS 759 FF +S H F ++ +N +++ L W+ + ++ M +S Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVFVMLLS 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,768 Number of Sequences: 336 Number of extensions: 3986 Number of successful extensions: 21 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -