BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31019 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25446| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) 29 3.2 SB_31598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_19650| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-05) 29 4.3 SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_33785| Best HMM Match : DUF23 (HMM E-Value=8.2e-36) 28 9.9 SB_14464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_25446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 83.8 bits (198), Expect = 1e-16 Identities = 35/66 (53%), Positives = 48/66 (72%) Frame = +1 Query: 583 VEWGYAFDVHINAFFPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYISF 762 VEWGYAFDVH+NAFFP L +LH Q+ I+ F+S + NT WL +++YY+YI+F Sbjct: 57 VEWGYAFDVHLNAFFPLLIILHVVQLFF---IIDHPWFISRFIGNTLWLIALVYYVYITF 113 Query: 763 LGYSNL 780 LGYS++ Sbjct: 114 LGYSDI 119 Score = 58.8 bits (136), Expect = 5e-09 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +1 Query: 223 KRYKYLKRLFKFNQMDFEFAAWQMVYLFIAPQKVFRNFNY 342 +R+KYLKR+ KF MDFEFA WQM+YL ++PQKV Y Sbjct: 5 RRWKYLKRILKFRHMDFEFALWQMLYLCVSPQKVIVTNRY 44 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +1 Query: 61 NFIL*SRNNIRGS*NKIKMKYSTSPTPNLHNYPRSTSPLPAPANYQPTTAS 213 NFIL + NNI + NKI +T+ T N YP S P P P A+ Sbjct: 12 NFILTNTNNIATTANKIATTVTTT-TANFTYYPHFISSSPPPPPPSPPAAA 61 >SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 148 HNYPRSTSPLPAPANYQPTTASASVKR 228 H YP P+P P +Y P + + S KR Sbjct: 193 HYYPTIAEPVPGPGSYNPRSYTTSSKR 219 >SB_8021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = -3 Query: 384 CRVVSRKL*FCMLPIVKVSEYFLRGNEQVNHLPSGEFEIHLIKFEQSLEVFIA 226 CR+V L + +P +K+S + N NH+P+ EF + + + ++ F+A Sbjct: 20 CRIVQGHLIYRRVPCLKISTKIIDDN---NHVPTIEFALRKMSDDATVVTFLA 69 >SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) Length = 669 Score = 29.5 bits (63), Expect = 3.2 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 4/97 (4%) Frame = +1 Query: 460 KVALFML-FVVFVDFIGAGILVSTLFWYLSNKHLRRDPE-GP--DVEWGYAFDVHINAFF 627 K LF FV + I +GI S ++S++H+ + PE GP W + F V +N Sbjct: 81 KYLLFAFNFVFWCSKIISGIYSSQ---FISHEHVTKTPEKGPRSSTIWSFVFLVLVNKPS 137 Query: 628 PPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASI 738 PPL +L I S+L+ G + + + +A I Sbjct: 138 PPLRVLISRPI----SVLAFLGIIKTTETPLYQIAGI 170 >SB_31598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 145 LHNYPRST-SPLPAPANYQPTTASASVKRYKYLKRLFKFNQMDFEFAAW 288 + N+P +T SP+ +P Y AS+ RY+ L+ + ++D+ W Sbjct: 392 MSNWPSTTKSPIDSPMKYFSCGASSVKDRYRLLRESCQSEKLDYLRCNW 440 >SB_19650| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-05) Length = 300 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 1/101 (0%) Frame = +1 Query: 193 YQPTTASASVKRYKYLKRLFKFNQMDFEFAAWQMVYLFIAPQKVFRNFNYRKHTKSQFAR 372 Y + + V Y YL + F + F A+++ L + R+F +H S+ Sbjct: 191 YDKSVPAFGVMLYSYLVLFYVFPCIILSFVAFRVTRLLNRRRTPRRSF---QHKGSRLLI 247 Query: 373 DDP-AFLVLLSIWLFLSSICFGLALDLTVGKVALFMLFVVF 492 + AF+V S+W+ L+++ + +LT + + L V+F Sbjct: 248 NVLIAFVVPYSLWVLLTALRLVINPELTYQQDTIVPLLVIF 288 >SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 133 PTPNLHNYPRSTSPLPAPANYQPT-----TASASVKRYKYLKRLF 252 P PN + YP + PA A Y+ T T SA V R+ Y F Sbjct: 185 PGPNPNEYPATNMTNPANARYRKTGLTGLTGSADVVRFMYASVTF 229 >SB_33785| Best HMM Match : DUF23 (HMM E-Value=8.2e-36) Length = 338 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 613 INAFFPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFW 726 +NAF P HCFQ V+F+S S LVS F+ Sbjct: 204 LNAFHRPYHCGHCFQSVVFSSNARFPRQKSELVSQRFF 241 >SB_14464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 112 KMKYSTSPTPNLHNYPRSTSPLPAP 186 K K ++SPTP N +TSP P P Sbjct: 30 KPKTTSSPTPTRPNTTATTSPTPTP 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,111,643 Number of Sequences: 59808 Number of extensions: 490294 Number of successful extensions: 1477 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1475 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -