BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31019 (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15240.1 68415.m01738 UNC-50 family protein contains Pfam pro... 147 6e-36 At2g24170.1 68415.m02888 endomembrane protein 70, putative simil... 31 0.66 At5g46240.1 68418.m05691 inward rectifying potassium channel (KA... 30 2.0 At5g44860.1 68418.m05499 expressed protein strong similarity to ... 30 2.0 At3g21250.1 68416.m02685 ABC transporter family protein similar ... 29 2.6 At5g38380.2 68418.m04636 expressed protein 28 6.1 At4g32890.1 68417.m04680 zinc finger (GATA type) family protein ... 28 6.1 At3g60350.1 68416.m06749 armadillo/beta-catenin repeat family pr... 28 6.1 At1g14470.1 68414.m01716 pentatricopeptide (PPR) repeat-containi... 28 6.1 >At2g15240.1 68415.m01738 UNC-50 family protein contains Pfam profile PF05216: UNC-50 family; contains 5 transmembrane domains; similar to inner nuclear membrane RNA-binding protein unc-50 related protein (GI:2735550) [Rattus norvegicus] Length = 252 Score = 147 bits (357), Expect = 6e-36 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 5/209 (2%) Frame = +1 Query: 172 PLPAPANYQPTTASASVKRYKYLKRLFKFNQMDFEFAAWQMVYLFIAPQKVFRNFNYRKH 351 P + + +++ A+ +Y +R+ K+ QMD E+ WQM+ L +P+ V+++ Y K Sbjct: 3 PTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQ 62 Query: 352 TKSQFARDDPAFLVLLSIWLFLSSICFGLALDLTVGKVALFMLFVVFVDFIGAGILVSTL 531 TK+Q+ARDDPAF+V+ S+ L ++++ + + D + + ++ V+F F+ G +++T Sbjct: 63 TKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSSSHAVVVVVSVLFTHFLITGAVIATC 122 Query: 532 FWYLSNKHLRRDPEGPD-----VEWGYAFDVHINAFFPPLSLLHCFQIVLFNSILSQAGF 696 W+L+N +LR + VEW Y FDVH N+FFP LL+ L + +L GF Sbjct: 123 CWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFL-SPLLIAHGF 181 Query: 697 VSCLVSNTFWLASIIYYMYISFLGYSNLP 783 + L+SN ++ YY Y++FLGY LP Sbjct: 182 IPLLLSNLLFMVGASYYHYLNFLGYDVLP 210 >At2g24170.1 68415.m02888 endomembrane protein 70, putative similar to MURA transposase of maize Mutator transposon Length = 637 Score = 31.5 bits (68), Expect = 0.66 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 11/112 (9%) Frame = +1 Query: 475 MLFVVFVDFIGAGILVSTLFWYLSNKHLRRDPEGPDVEWGYAFDVHINAFFPPLS--LL- 645 M+ V+F+ + A I++ TL+ +SN + E E G+ VH + F PP + LL Sbjct: 282 MMIVLFLSGMVAMIMLRTLYRDISNYNQLESHEEALEETGWKL-VHGDVFRPPTNPELLC 340 Query: 646 -------HCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYISFL-GYSN 777 CF ++L I + GF+S A ++ ++++ L GY++ Sbjct: 341 VYAGTGVQCFGMILVTMIFACLGFLSPSNRGGLMTAMLLLWVFMGLLAGYAS 392 >At5g46240.1 68418.m05691 inward rectifying potassium channel (KAT1) identical to K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 677 Score = 29.9 bits (64), Expect = 2.0 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 7/116 (6%) Frame = +1 Query: 319 KVFRNFNYRKHTKSQFARDDPAFLVLLSIWLFLSS-IC-FGLALDLTVGKVALFMLFVVF 492 ++ ++ RKH S F A+ + L + + S+ IC F A +T K A+F++ + Sbjct: 40 RINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQFAF-ITYKKDAIFIIDNIV 98 Query: 493 VDFIGAGILVSTLFWYL-SNKHLRRD-PEGPDVEW---GYAFDVHINAFFPPLSLL 645 F I+++ YL S+ +L D P+ + + +AFDV A F PLSLL Sbjct: 99 NGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLL 154 >At5g44860.1 68418.m05499 expressed protein strong similarity to unknown protein (gb AAC79135.1) Length = 321 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/54 (31%), Positives = 33/54 (61%) Frame = +1 Query: 388 LVLLSIWLFLSSICFGLALDLTVGKVALFMLFVVFVDFIGAGILVSTLFWYLSN 549 LV S++L + +A+DL +A+F + V+FV F+G + + T +W+L++ Sbjct: 141 LVYNSVFLLFLVVLI-VAIDLQSVILAVFSMVVIFVLFLGVHVYM-TAWWHLAS 192 >At3g21250.1 68416.m02685 ABC transporter family protein similar to MRP-like ABC transporter GB:AAC49791 from [Arabidopsis thaliana] Length = 1294 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 661 VLFNSILSQAGFVSCLVSNTFWLASII 741 +L++S+L Q GFV ++T+WLA I Sbjct: 730 LLWSSVLGQVGFVVFQAASTYWLAFAI 756 >At5g38380.2 68418.m04636 expressed protein Length = 336 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 400 SIWLFLSSICFGLALDLTVGKVALFMLFVVF 492 S W FLS+I FG+ L V +A L +VF Sbjct: 228 SAWAFLSTIIFGIILIFYVDNIAEERLHMVF 258 >At4g32890.1 68417.m04680 zinc finger (GATA type) family protein GATA transcription factor 3, Arabidopsis thaliana, gb:Y13650 Length = 308 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 647 CSSESGGKNALMCTSKA*PHSTSGPSGSRRRC 552 C GG+ L C ++ P +GP G + C Sbjct: 190 CGESGGGRRCLHCATEKTPQWRTGPMGPKTLC 221 >At3g60350.1 68416.m06749 armadillo/beta-catenin repeat family protein / F-box family protein contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain; similar to F-box protein FBL2 (GI:6010699) [Rattus norvegicus] Length = 928 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 679 LSQAGFVSCLVSNTFWLASIIYYMYISFLGYSNL 780 LS GF+ CL N L ++ Y+S G SN+ Sbjct: 207 LSDLGFLDCLNINEEALGKVVSLRYLSVAGTSNI 240 >At1g14470.1 68414.m01716 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 540 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +1 Query: 625 FPPLSLLHCFQIVLFNSILSQAGFVSCLVSNTFWLASIIYYMYISF 762 FP L+ +H Q+++FNS+ Q+ + S ++S L + YY + F Sbjct: 19 FPQLNQIHA-QLIVFNSLPRQSYWASRIISCCTRLRAPSYYTRLIF 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,025,989 Number of Sequences: 28952 Number of extensions: 328509 Number of successful extensions: 1106 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1100 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -