BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31018 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0847 + 23630937-23631099,23631200-23631396,23631604-236317... 30 1.7 02_05_0232 + 27041793-27042087,27042822-27042943,27043098-270432... 29 2.9 03_06_0155 - 32031370-32031707,32033066-32033279 28 6.8 >12_02_0847 + 23630937-23631099,23631200-23631396,23631604-23631738, 23631904-23632077,23632195-23632407,23632507-23632751, 23632890-23632930,23633200-23633238,23633552-23633565 Length = 406 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +3 Query: 429 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLGR 608 +I E+R+R + ++ A+L+AMK+ N ++ E N +LE K+QL Sbjct: 41 EIAEERERFQLEQRGNDALLEAMKE-ELVAANNELEAAKEEISRKNNELE--SVKKQLQE 97 Query: 609 GE 614 E Sbjct: 98 SE 99 >02_05_0232 + 27041793-27042087,27042822-27042943,27043098-27043219, 27043601-27043705,27043828-27044257,27044356-27044517, 27044565-27045260,27045349-27046128,27046441-27046654, 27047621-27047981,27047993-27048140,27048276-27048419, 27048784-27048888,27049749-27049794,27050089-27050255, 27050338-27050490,27050654-27050950,27051053-27051220, 27051298-27051363,27051451-27051927,27052031-27052768, 27052935-27053120 Length = 1993 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +3 Query: 438 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQ 599 E+ ++ ++ + AMLQ +KD N +Q+K ++ ++E +TK Q Sbjct: 1431 EEAKKFQKIKMDLLAMLQRVKDVENLNRNEKMQRKDMEEKIARQRMEIEETKRQ 1484 >03_06_0155 - 32031370-32031707,32033066-32033279 Length = 183 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQL 602 IEE +QR EEA + +Q + +A K + + + G+ + R K+ E L Sbjct: 98 IEELKQREEEATQAQQQADVKLLEAKKLASQYQKEADKCSSGMDTCEEAREKSSEAL 154 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,633,974 Number of Sequences: 37544 Number of extensions: 204885 Number of successful extensions: 746 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -