BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31018 (614 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 5.9 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 23 5.9 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 5.9 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 281 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWI 192 PL P DVFL F V P + E W+ Sbjct: 12 PLSYPQTDVFLVCFSVVSPSSFENVKEKWV 41 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.4 bits (48), Expect = 5.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 13 TSLCCRSKNQCRVTE*PTS 69 T +CC S+ Q R + PTS Sbjct: 74 TLVCCASEQQTRTSSFPTS 92 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +2 Query: 479 GYAPGHERCQQD---RTQLHHPKEERKLRFEQCPAGAQQD--QGAAWKRR 613 G PGHERC + +Q H + +F PA + + GA+ +RR Sbjct: 477 GRNPGHERCVDEIEAASQKLHQWRQAMDKFADRPAREKTEPASGASSRRR 526 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,868 Number of Sequences: 2352 Number of extensions: 6915 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -