BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31018 (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 3.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 465 EKKRQAMLQAMKDASKTGPNFTIQKKSE 548 EKKRQA L + +A + G T ++ E Sbjct: 313 EKKRQAFLDLLIEAGQNGVLLTDKEVKE 340 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFG 557 I + +R++ EK +L + +AS PN + NFG Sbjct: 327 INTRGERIQLTEKNGIDVLGNIMEASILSPNQNVYGDLHNFG 368 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 279 AVCAIR*CIPSTVHP 235 A C I C P TVHP Sbjct: 357 AFCNIVSCSPQTVHP 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,781 Number of Sequences: 438 Number of extensions: 1860 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -