BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31018 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23930.1 68416.m03006 expressed protein 32 0.35 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 1.9 At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR... 29 3.2 At3g43160.1 68416.m04554 expressed protein merozoite surface pro... 28 5.7 At5g25070.1 68418.m02971 expressed protein 27 7.5 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 27 7.5 At5g23575.1 68418.m02766 transmembrane protein, putative similar... 27 9.9 At3g61350.1 68416.m06865 SKP1 interacting partner 4 (SKIP4) almo... 27 9.9 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 27 9.9 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 9.9 At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to... 27 9.9 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 31.9 bits (69), Expect = 0.35 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 174 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQR 281 K + G IK +D++ + QLKE EWRK+R Sbjct: 21 KDQSRGRRHLIKERDEREKVMFLQLKEAEREWRKER 56 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 171 PKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEW 269 PK+E EG+ E + + +K +++KE +EW Sbjct: 232 PKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEW 264 >At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1038 Score = 28.7 bits (61), Expect = 3.2 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +3 Query: 429 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE 578 D EKRQ L EAE+ R + S G +F + K SE F +S E Sbjct: 502 DEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSE-FSISGRAFE 550 >At3g43160.1 68416.m04554 expressed protein merozoite surface protein 2 (MSP-2), EMBL:PFU72951, Plasmodium falciparum Length = 295 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 202 SSSVKTRSGRTWMNS*RNTSTNGANSGPRRRMSSNALKRSR 324 +S+ +TRSGR +++ +ST NS R SS K R Sbjct: 103 NSTTRTRSGRGFIDYVLESSTGTENSSTRTAESSTRTKNGR 143 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 27.5 bits (58), Expect = 7.5 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +3 Query: 438 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLGRGE 614 EKR EAEKK A + K+A + + KS N Q+E K +L + E Sbjct: 565 EKRMPELEAEKKVAASTRNFKEAGR----IAAEAKSLNLEKDKTQMETGKANAELEKAE 619 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 27.5 bits (58), Expect = 7.5 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +3 Query: 435 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK 593 +EKR+R+EE E+K +KD N ++ + E SN +LE N K Sbjct: 112 DEKRKRMEELEEKLVVNESLIKDLQLQVLN--LKTELEEARNSNVELELNNRK 162 >At5g23575.1 68418.m02766 transmembrane protein, putative similar to cleft lip and palate transmembrane protein 1 [Homo sapiens] GI:4039014; contains Pfam profile PF05602: Cleft lip and palate transmembrane protein 1 (CLPTM1) Length = 593 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 168 APKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWR 272 +PK E +PE K D+K +E E+I+ W+ Sbjct: 182 SPKDSDESEPEVEKVGDKKSDPKEEVPVEWISLWK 216 >At3g61350.1 68416.m06865 SKP1 interacting partner 4 (SKIP4) almost idential to SKP1 interacting partner 4 GI:10716953 from [Arabidopsis thaliana], 42 aa extension at N-terminal; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 358 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 117 IPPRQTCWLFIECRTGRSRSLSHSALVLGPAAQRRWNV 4 +PP T + C T + ++ L L P A+R W++ Sbjct: 154 VPPLSTKRCYFACETLDGKIIAIGGLGLNPNAKRTWDI 191 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 27.1 bits (57), Expect = 9.9 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 438 EKRQRLEE-AEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLGRGE 614 E+R++ EE A K+ +A + ++A + T +KK E + ER + +E+ R E Sbjct: 444 ERRRKEEEEARKREEAKRREEEEAKRREEEETERKKREEEEARKREEERKREEEEAKRRE 503 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 27.1 bits (57), Expect = 9.9 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA-QLERNKTKEQ 599 ++ K++ KK++ + K +KTG + +KK+ + +S +++RN T E+ Sbjct: 898 VDVKQETGSPDTKKKEGASSSSKKDTKTGEDKKAEKKNNSETMSEGKKIDRNNTDEK 954 >At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to myosin heavy chain PCR43 (PIR:T00727) [Arabidopsis thaliana]; similar to ESTs gb|R30087 and gb|AA394762 Length = 1538 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 432 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKK 542 +E+K+++LEE EKK Q + +++ + N + K Sbjct: 1018 LEDKKKKLEETEKKGQQLQESLTRMEEKCSNLESENK 1054 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,524,701 Number of Sequences: 28952 Number of extensions: 147171 Number of successful extensions: 555 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -