BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31017 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.) 223 1e-58 SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.) 143 1e-34 SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0) 143 1e-34 SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0) 143 1e-34 SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29) 129 2e-30 SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037) 74 9e-14 SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10) 51 1e-06 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 49 3e-06 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 49 3e-06 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 49 3e-06 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 49 3e-06 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 49 3e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 49 3e-06 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 47 2e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 3e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 44 8e-05 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 40 0.002 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12) 38 0.007 SB_49791| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11) 37 0.013 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 36 0.038 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 34 0.089 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 32 0.36 SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055) 32 0.47 SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01) 31 0.83 SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) 29 2.5 SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026) 29 4.4 SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) 28 5.8 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) 28 7.7 SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 28 7.7 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 28 7.7 >SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 223 bits (545), Expect = 1e-58 Identities = 111/150 (74%), Positives = 115/150 (76%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 188 IQKESTLHLVXXXXXXXXXXXXXNYSTPXXXXXXXXXXXLAVLRFYKVDENGKIHRLRRE 367 IQKESTLHLV NY+TP LAVL++YKVDENGKI RLRRE Sbjct: 61 IQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKKKKVKLAVLKYYKVDENGKITRLRRE 120 Query: 368 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF 457 C E CGAGVFMA DR YCGKC T VF Sbjct: 121 CPSESCGAGVFMASHFDRQYCGKCCLTYVF 150 >SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 61 IQKESTLHLV 70 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 137 IQKESTLHLV 146 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 213 IQKESTLHLV 222 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 289 IQKESTLHLV 298 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 365 IQKESTLHLV 374 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 441 IQKESTLHLV 450 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 517 IQKESTLHLV 526 >SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0) Length = 381 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 61 IQKESTLHLV 70 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 137 IQKESTLHLV 146 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 213 IQKESTLHLV 222 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 289 IQKESTLHLV 298 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 365 IQKESTLHLV 374 >SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0) Length = 147 Score = 143 bits (346), Expect = 1e-34 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 188 IQKESTLHLV 217 IQKESTLHLV Sbjct: 61 IQKESTLHLV 70 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/69 (57%), Positives = 53/69 (76%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQI VK KT TL+VE SDT+E+VK KIQ++EGIPP QRL++ ++L D R+L+DYN Sbjct: 77 MQISVKA-HWKTFTLDVEASDTVESVKEKIQNREGIPPKVQRLLYEEEELVDNRSLADYN 135 Query: 188 IQKESTLHL 214 I++ S LHL Sbjct: 136 IKQGSILHL 144 >SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29) Length = 142 Score = 129 bits (312), Expect = 2e-30 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 79 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 138 Query: 188 IQK 196 IQK Sbjct: 139 IQK 141 >SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037) Length = 150 Score = 74.1 bits (174), Expect = 9e-14 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 113 IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 217 IPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV Sbjct: 2 IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 36 >SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10) Length = 333 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/69 (43%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +2 Query: 14 IFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 190 I V TLTG+ I + + P TI VK I+ K G P +QQRL+F G+ L D T I Sbjct: 73 IAVLTLTGERILIPFKSPKHTIIEVKYLIEAKGGYPKDQQRLVFNGQVLSDEDTFEKVGI 132 Query: 191 QKESTLHLV 217 +TLHL+ Sbjct: 133 FAGATLHLI 141 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 6 DVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 630 DVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 43 DVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 1881 DVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 35 DVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 84 DVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 49 DVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRANW 601 DVVKRRPVNCNTTHYRANW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 3/70 (4%) Frame = +2 Query: 2 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQ---DKEGIPPNQQRLIFAGKQLEDGRT 172 V M I KTL +T +E+ +T+ +K KI+ K+ P +LI+AGK L D Sbjct: 65 VNMIITFKTLQQQTFKVEIGEDETVLKLKQKIEADKGKDAYPHGNIKLIYAGKILNDDNP 124 Query: 173 LSDYNIQKES 202 L +YNI ++S Sbjct: 125 LKEYNIDEKS 134 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 583 EGGARYPIRPIVSRITIHWPSFYN 654 +GGA PIRPIVSRITIHWP+FYN Sbjct: 35 DGGA--PIRPIVSRITIHWPAFYN 56 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRAN 604 DVVKRRPVNCNTTHYRAN Sbjct: 23 DVVKRRPVNCNTTHYRAN 40 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +1 Query: 586 GGARYPIRPIVSRITIHWPSFYN 654 GGA PIRPIVS ITIHWPSFYN Sbjct: 38 GGA--PIRPIVSHITIHWPSFYN 58 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 604 IRPIVSRITIHWPSFY 651 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 657 DVVKRRPVNCNTTHYRAN 604 D KRRPVNCNTTHYRAN Sbjct: 80 DGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 604 IRPIVSRITIHWPSFYNV 657 +RP+VSRITIHW SFYNV Sbjct: 33 LRPVVSRITIHWTSFYNV 50 >SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12) Length = 348 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED-GRTLSDY 184 M++ V G TL+V +EN +A ++ + G+P ++ L G QL D +TL+ Y Sbjct: 1 MKVTVTGEDGSIFTLDVSVDLEVENFRALLEFESGVPASEISLYHDGVQLSDLKKTLTAY 60 Query: 185 NIQKESTLHLV 217 ++++ + +V Sbjct: 61 SVKENDVILMV 71 >SB_49791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 109 M ++++TLTG L V P +TI +VKAKIQ E Sbjct: 1 MDLYIQTLTGTAFELRVSPFETIMSVKAKIQRLE 34 >SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11) Length = 744 Score = 37.1 bits (82), Expect = 0.013 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 11 QIFVKTLTGKTITLEVEPSDT-IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 Q+F T TL +D + +K++I+ K GIP + QRL F K+L D TL+ N Sbjct: 7 QVFAALPTEDVCTLRDLTTDMHVFQLKSRIELKTGIPGDIQRLHFMNKELYDDATLAKVN 66 Query: 188 IQK 196 +++ Sbjct: 67 LKQ 69 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 610 PIVSRITIHWPSFYNV 657 P +SRITIHWPSFYNV Sbjct: 77 PYMSRITIHWPSFYNV 92 >SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) Length = 198 Score = 35.5 bits (78), Expect = 0.038 Identities = 23/60 (38%), Positives = 32/60 (53%) Frame = +2 Query: 8 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 187 MQ+ VKTL +T T V +EGIP +QRLIF GK L+D + L +++ Sbjct: 1 MQVTVKTLDSETRTFTVS--------------EEGIPAERQRLIFKGKVLQDEKKLKEFD 46 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1076 Score = 34.3 bits (75), Expect = 0.089 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +2 Query: 2 VKMQIFVKT--LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTL 175 V++++ V+ +G L++ + TIE ++ ++ DK G PP QR I K + +L Sbjct: 32 VRLRVVVEDSETSGGAFNLQIPLNTTIEKLQNEVADKYGFPPKVQRWIIGKKMAKPNESL 91 Query: 176 SDYNIQK 196 +++ Sbjct: 92 LQCKVRE 98 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 619 SRITIHWPSFYNV 657 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 110 GIPPNQQRLIFAGKQLEDGRTLSDYN 187 GIP +QRLIF GK L+D + L +++ Sbjct: 1 GIPAERQRLIFKGKVLQDEKKLKEFD 26 >SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055) Length = 411 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +2 Query: 17 FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQK 196 FV G+ ITL P + ++ + G P ++ K LED T++D + Q Sbjct: 169 FVVMPEGQVITLHCNPRQSFSELRNHFSSEFGQPAEAILMLHEDKILEDQGTIADLSHQP 228 Query: 197 ESTLHL 214 +TL + Sbjct: 229 GATLQI 234 >SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 71 TIENVKAKIQDKEGIPPNQQRLIFA-GKQLEDGRTLSDYNIQKESTLHL 214 T+ ++K + +K G+ + RL+ GK++ D L DYNI T+ L Sbjct: 86 TVGDLKTMVTNKTGLHVSVFRLVIPEGKEMFDCNLLKDYNISTGDTIRL 134 >SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01) Length = 792 Score = 31.1 bits (67), Expect = 0.83 Identities = 16/64 (25%), Positives = 34/64 (53%) Frame = +2 Query: 14 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQ 193 + ++T G T+ +E+ ++E++KA+ + + GIP RL LED + + Sbjct: 185 MLLQTRGGSTLEIEITERTSVEDLKAEAELRVGIPVELIRLQVNKVNLEDSEKICERGHL 244 Query: 194 KEST 205 +++T Sbjct: 245 QKAT 248 >SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) Length = 180 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 61 AVRYHRECES*NSRQRGNPSQSTEVDLCWKAAGRWTYPLGLQY 189 + Y +E E + RQR +S E D+C K R+T Y Sbjct: 39 STEYTQESEGLDERQRARGKKSFECDICGKCFSRFTITTKYNY 81 >SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026) Length = 309 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = +2 Query: 20 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGR---TLSDYNI 190 V + G+T + P +I +K KI + +QRL++ +L++ + LS++ + Sbjct: 60 VAMMGGETTVIPYNPVMSIAELKLKISQNIRVDRLKQRLMYNDTELKENKGSGKLSEFGV 119 Query: 191 QKESTLHLV 217 +T+ L+ Sbjct: 120 PPYATISLI 128 >SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) Length = 635 Score = 28.3 bits (60), Expect = 5.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 335 ENGKIHRLRRECTGEQC 385 + G+IH L++EC G QC Sbjct: 106 DGGEIHNLQQECIGSQC 122 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 430 AVVTVLHHRHEHSGA 386 A++TV+HHRH H A Sbjct: 525 AIITVIHHRHHHHPA 539 >SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) Length = 1105 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 103 QRGNPSQSTEVDLCWKAAGRWTYPLGLQYPEGIHPPPGVEAS 228 QRG S+ T + W+ +G + L IHPP V S Sbjct: 299 QRGVSSRKTMISKAWQVSGVYHITLDANVTPVIHPPRRVAIS 340 >SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 794 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 323 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRH 424 YK D GK+ L+R C ++C ++ V D + Sbjct: 364 YKCDNCGKVGHLKRVCQSKECKETKYVEVSVDNN 397 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 323 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHS 445 YK D GK+ L+R C ++C + + C +C S Sbjct: 515 YKCDNCGKVGHLKRVCQSKECKKXXXXQGGKPKTACHRCGS 555 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 323 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRH 424 YK D GK+ L+R C ++C ++ V D + Sbjct: 207 YKCDNCGKVGHLKRVCQSKECKETKYVEVSVDNN 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,484,776 Number of Sequences: 59808 Number of extensions: 387032 Number of successful extensions: 1357 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1354 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -