BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31016 (559 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 166 9e-42 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 164 5e-41 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_56| Best HMM Match : Actin (HMM E-Value=0) 163 1e-40 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 162 2e-40 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 161 5e-40 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 143 8e-35 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 54 1e-07 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 50 1e-06 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 0.84 SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) 29 3.4 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 3.4 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 166 bits (404), Expect = 9e-42 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTVMSGGTTMYPG+ADRMQKEI+ALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 269 ANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 328 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 329 MWISKQEYDESGPAIVHRKCF 349 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 164 bits (398), Expect = 5e-41 Identities = 75/81 (92%), Positives = 79/81 (97%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTV+SGGTTMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 258 ANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 317 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 318 MWISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 163 bits (395), Expect = 1e-40 Identities = 74/81 (91%), Positives = 79/81 (97%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 296 ANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 355 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 356 MWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 163 bits (395), Expect = 1e-40 Identities = 74/81 (91%), Positives = 79/81 (97%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 295 ANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 354 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 355 MWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 162 bits (394), Expect = 2e-40 Identities = 74/81 (91%), Positives = 79/81 (97%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTV+SGG+TMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 296 ANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 355 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 356 MWISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 161 bits (390), Expect = 5e-40 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 ANTV+SGG+TM+PGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQ Sbjct: 295 ANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 354 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWISK+EYDESGP IVHRKCF Sbjct: 355 MWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 143 bits (347), Expect = 8e-35 Identities = 64/81 (79%), Positives = 74/81 (91%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 194 +N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGSILASLSTFQQ Sbjct: 69 SNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQ 128 Query: 195 MWISKEEYDESGPGIVHRKCF 257 MWI+KEEY E GP IVHRKCF Sbjct: 129 MWIAKEEYHEYGPPIVHRKCF 149 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 53.6 bits (123), Expect = 1e-07 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 16/96 (16%) Frame = +3 Query: 18 NTVMSGGTTMYPGIADRMQKEITA----------------LAPSTIKIKIIAPPERKYSV 149 N V+SGG+TM+ R+Q++I + P I+ ++I+ ++Y+V Sbjct: 245 NIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAV 304 Query: 150 WIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 257 W GGS+LAS F + +K +YDE GP I F Sbjct: 305 WFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF 340 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/57 (35%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +3 Query: 18 NTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIA---PPERKYSVWIGGSILASL 179 + +++GG T+ G +R+ +E+ + P ++++K+I+ E++++ WIGGSILASL Sbjct: 174 SVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILASL 230 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 108 KIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 230 KI+I PP RK+ V++GG++LA + W++++EY+E G Sbjct: 358 KIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 9/78 (11%) Frame = +3 Query: 18 NTVMSGGTTMYPGIADRMQKEITALAPST-------IK-IKIIAPP-ERKYSVWIGGSIL 170 N V+ GGT M PG R+ +EI L S IK +K+ PP + W+GG+I Sbjct: 80 NIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGGAIF 139 Query: 171 ASLSTFQQMWISKEEYDE 224 SL ++E Y + Sbjct: 140 GSLEVLADRSTTRERYQQ 157 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 30.7 bits (66), Expect = 0.84 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 3 FGTRANTVMSGGTTMYPGIADRMQKEITALAP 98 FG R N ++GG TMY R+++E+ A+ P Sbjct: 128 FG-RCNVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 30.7 bits (66), Expect = 0.84 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -1 Query: 166 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPDMTVLALVPN 2 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ ++P+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPECNSAIVLPD 810 >SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) Length = 493 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 5 RHEGQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREEV 142 R +GQ R + RY RQ E AL+ +++D R + EV Sbjct: 122 RDDGQLRETKLQQENTRYERQMREMREEMSALEKREEDMRKRKSEV 167 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 56 YRRQDAEGDHRPRALDHQDQDHRSPREE 139 +RRQDA DHR + DH QD PR++ Sbjct: 664 HRRQDA--DHRRQDADHHRQDVVHPRQD 689 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 134 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 15 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 134 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNHLTELGIVKEKIIAPPE 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,928,241 Number of Sequences: 59808 Number of extensions: 320170 Number of successful extensions: 1065 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -