BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31009 (577 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0488 - 22647196-22647561,22647847-22647999,22648716-226496... 30 1.5 05_03_0496 + 14706959-14707020,14707173-14707538,14708070-147082... 28 6.1 >01_05_0488 - 22647196-22647561,22647847-22647999,22648716-22649663, 22649783-22649830 Length = 504 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +3 Query: 48 RPCGYRH----RCPPLQRTTLRSFGLNSTPAPMEL 140 R CGYR R P L R TL S+ +T AP+ L Sbjct: 252 RGCGYRRVELRRAPKLVRLTLESWSSTTTTAPLRL 286 >05_03_0496 + 14706959-14707020,14707173-14707538,14708070-14708209, 14708319-14708566,14708814-14708946,14709096-14709159, 14709284-14709380,14709505-14709607,14709702-14709838, 14710063-14710152,14710240-14710401 Length = 533 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 577 FFFFFFISNELYC 539 FFFFFF S ++YC Sbjct: 102 FFFFFFFSGDVYC 114 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,919,832 Number of Sequences: 37544 Number of extensions: 258806 Number of successful extensions: 737 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -