BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31004 (729 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24250.1 68418.m02853 hypothetical protein 28 5.5 >At5g24250.1 68418.m02853 hypothetical protein Length = 226 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 729 KCTELRIFRYSLSMFTFYNLPLSLKCFSNRFHYFFL 622 K +E+++++Y + F LS CFS +FFL Sbjct: 58 KVSEVKLYKYIPTKFAAVQRRLSYHCFSLSLFFFFL 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.310 0.123 0.331 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,514,510 Number of Sequences: 28952 Number of extensions: 86083 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -