BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31000 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 31 0.089 SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma... 27 1.9 SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharo... 27 1.9 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 26 4.4 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 31.5 bits (68), Expect = 0.089 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 3/93 (3%) Frame = +2 Query: 137 PDKYQYQYQTSNGISGQEQGALVNEGREDASIAVQG--SSGYTAPDGTPIQITYIADANG 310 PD + G G+E + G A+ +G S GYT+P + + Y + Sbjct: 1500 PDAAAFSPLVQGGSEGRE--GFGDYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPS 1557 Query: 311 YQPSGAHLPTTPAPLP-IPDYIARAIEYIRTHP 406 Y PS T+PA +P P Y + Y T P Sbjct: 1558 YSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSP 1590 >SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Manual Length = 462 Score = 27.1 bits (57), Expect = 1.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 475 CFNNSRPYQLSYNLNTLADLWLGWM 401 CF+ P Q NL + A+LW WM Sbjct: 372 CFDGYLPAQERSNLKSKAELWNEWM 396 >SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 448 Score = 27.1 bits (57), Expect = 1.9 Identities = 20/84 (23%), Positives = 32/84 (38%) Frame = +2 Query: 107 QIVSQDADVFPDKYQYQYQTSNGISGQEQGALVNEGREDASIAVQGSSGYTAPDGTPIQI 286 Q+ ++ +D+ PD S G E + + + V SS + G + Sbjct: 96 QLATELSDLLPDGLDKTLFLSTGGEANEAALRMAKVYTNKYECVAFSSSWHGVTGGAASL 155 Query: 287 TYIADANGYQPSGAHLPTTPAPLP 358 T+ A GY P+ T P P P Sbjct: 156 TFAAARRGYGPALPGSYTIPEPNP 179 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.8 bits (54), Expect = 4.4 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +2 Query: 197 ALVNEGREDASIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAP 352 AL+ G S VQ + YT+ G P T +A A + +G ++ +P Sbjct: 43 ALLPTGLLMGSPFVQSPTSYTSMHGLPFSTTQMAAAPAHPTTGYNVSRVTSP 94 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,135,078 Number of Sequences: 5004 Number of extensions: 42472 Number of successful extensions: 144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -