BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30999 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0810 + 7429834-7429960,7430534-7430696,7430796-7430844,743... 50 2e-06 08_02_0501 + 17836948-17837373,17837857-17839184,17839270-178393... 30 1.8 08_02_0910 - 22522465-22522473,22522565-22522651,22522707-225227... 28 7.4 05_02_0115 - 6758540-6758771,6759417-6759524,6759670-6759840,675... 28 7.4 04_01_0206 + 2507827-2508705,2508844-2509902 28 7.4 >12_01_0810 + 7429834-7429960,7430534-7430696,7430796-7430844, 7431203-7431385,7431824-7431898,7431963-7432148, 7432362-7432450,7432892-7433444 Length = 474 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/40 (50%), Positives = 27/40 (67%) Frame = +1 Query: 661 GRTDLIEYAKKENIPVSATPKEPWSTDENIMHISYESGVL 780 GR D IEYAKK N+P+ T K +S D N+ H+S+E +L Sbjct: 226 GREDAIEYAKKHNVPIPVTKKSIYSRDRNLWHLSHEGDIL 265 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 288 IAHGATGKGNDQVRFELSMYSLWPEGKV 371 +AHG TGKGNDQVRFEL+ Y+L PE KV Sbjct: 188 VAHGCTGKGNDQVRFELTFYALNPELKV 215 >08_02_0501 + 17836948-17837373,17837857-17839184,17839270-17839380, 17839719-17839998,17840275-17840396,17840451-17840556, 17840814-17841020,17841130-17841255,17841719-17841817, 17842265-17842456,17842555-17843073 Length = 1171 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 743 SSVDQGSFGVAETGIFSFLAYSIKSVLPLKPLEEFRDAPRCYNL 612 SS D+G GV S Y+ S +P E+FR A C+ L Sbjct: 56 SSSDEGGGGVYPGNAISTTKYTAASFVPKSLFEQFRRAANCFFL 99 >08_02_0910 - 22522465-22522473,22522565-22522651,22522707-22522768, 22523170-22523697,22524954-22525047 Length = 259 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 628 GASLNSSKGFRGRTDLIEYAKKENIPV 708 GA +N GF +T + ++ KK+N+P+ Sbjct: 206 GAEMNYISGFYHKTHIYKFVKKKNLPL 232 >05_02_0115 - 6758540-6758771,6759417-6759524,6759670-6759840, 6759967-6760077,6760562-6760663,6761139-6761366, 6761568-6761696,6761753-6761869,6761955-6762301, 6762377-6762931,6763104-6763182,6763429-6763595, 6763857-6764075,6764956-6765139,6765175-6765371, 6765717-6766035,6766379-6766538,6767642-6767794, 6767911-6768013 Length = 1226 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +1 Query: 622 HRGASLNSSKGFRGRTDLIEYAKKENIPVSATPKEPWSTDEN 747 ++G + SSKG+RG ++ + + + + P EP++ D++ Sbjct: 789 NKGGEIGSSKGWRGSINIADSLGDDEVDL-VIPHEPYNADKD 829 >04_01_0206 + 2507827-2508705,2508844-2509902 Length = 645 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = +1 Query: 376 LYKKKEQIYLHTVNKVSSVWSL*K---INRQVIHFF--LVIQIKIKNELS*SYSHT 528 L K E+I+ NK+S++WS K N Q++H+ +I+ + ELS Y+H+ Sbjct: 156 LSKYGERIHALRCNKLSNIWSSPKEVYRNNQLLHYLQDRDHRIREEEELSLQYAHS 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,724,748 Number of Sequences: 37544 Number of extensions: 412527 Number of successful extensions: 825 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -