BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30999 (796 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13071-4|AAA20671.1| 510|Caenorhabditis elegans Hypothetical pr... 30 1.7 AF016416-4|AAB65273.2| 150|Caenorhabditis elegans Hypothetical ... 30 1.7 U28738-2|AAA68309.4| 982|Caenorhabditis elegans Hypothetical pr... 28 6.7 >U13071-4|AAA20671.1| 510|Caenorhabditis elegans Hypothetical protein T22F7.1 protein. Length = 510 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 509 DNSFLIFIWITKKKCITCLFIFYKDHTDDTLFTVCKYIC 393 D S + IW+ K C +C +IF + + T C+ C Sbjct: 420 DTSLHLIIWLVAKFCASCCYIFCFIYAAELFPTWCRSCC 458 >AF016416-4|AAB65273.2| 150|Caenorhabditis elegans Hypothetical protein F29A7.3 protein. Length = 150 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 313 EMTKCGLN*ACIRYGQKERYVLYKKKEQIYLHTVNKVSSVWSL 441 E C LN A + G+K Y +Y Q YL T+N + W++ Sbjct: 105 EQPSCKLNVALLLNGKK--YQIYSNDTQHYLWTINAAADGWTI 145 >U28738-2|AAA68309.4| 982|Caenorhabditis elegans Hypothetical protein T28D9.7 protein. Length = 982 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 292 PTEPLEREMTKCGLN*ACIRYGQKERYVLYKKKEQIY 402 P + L R+M K C + +K R +YKKK Q Y Sbjct: 780 PMDALTRQMKKVATCSCCKKPIEKSREPIYKKKSQSY 816 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,721,462 Number of Sequences: 27780 Number of extensions: 404607 Number of successful extensions: 1070 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -