BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30999 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24830.1 68417.m03557 arginosuccinate synthase family contain... 50 2e-06 >At4g24830.1 68417.m03557 arginosuccinate synthase family contains Pfam profile: PF00764 arginosuccinate synthase Length = 494 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 658 RGRTDLIEYAKKENIPVSATPKEPWSTDENIMHISYESGVL 780 +GR D IEYAKK N+PV T K +S D N+ H+S+E +L Sbjct: 245 QGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDLL 285 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 288 IAHGATGKGNDQVRFELSMYSLWPEGKV 371 +AHG TGKGNDQVRFEL+ +SL PE KV Sbjct: 208 VAHGCTGKGNDQVRFELTFFSLNPELKV 235 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,397,560 Number of Sequences: 28952 Number of extensions: 365686 Number of successful extensions: 800 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -