SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30997
         (748 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    24   1.5  

>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 18/70 (25%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
 Frame = +2

Query: 485 PSIHRPSIYCPGLRCPYIRRPNLRCR-IYRPSVHCSSRDHRCPCCSSIHCSSRDYRRRGR 661
           PS  +P    P  R P   R ++R    Y P      +++R    SS+H ++       +
Sbjct: 69  PSGGQPPQGMPYPRFPPYDRMDIRAAGYYGPQQQMDGQEYRPDSPSSMHMANTAAPNGHQ 128

Query: 662 PSIYYPSCLL 691
             + Y SC L
Sbjct: 129 TQVVYASCKL 138


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,133
Number of Sequences: 336
Number of extensions: 1422
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19923648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -