BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30993 (832 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0165 + 22851863-22852566,22852811-22852964,22853112-228532... 28 7.9 >05_05_0165 + 22851863-22852566,22852811-22852964,22853112-22853261, 22853769-22853930,22854070-22854242,22854330-22854396, 22854556-22854722,22855216-22855374,22856187-22856276, 22856392-22856483,22856587-22856681,22857328-22857405, 22858364-22858459,22859132-22859206,22859290-22859381, 22859462-22859624,22859734-22859794,22860016-22860116, 22860567-22860614 Length = 908 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 20 IGVVTDSKENVHESKG**CEYIKWNGIGRERF 115 + ++T S ++ HE CE ++W G GRE F Sbjct: 354 VAIMTSSVKDNHEHITAICERLEWFGRGRENF 385 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,769,524 Number of Sequences: 37544 Number of extensions: 382258 Number of successful extensions: 697 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -