BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30991 (537 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.65 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.65 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.0 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 24.6 bits (51), Expect = 0.65 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 185 DQRKC**NEKYRARCTYCRDWRSVQEG--RACRKDDSRNLGRFYDSGAEDISSSGSD 349 +++ C +++ R RC YCR + + G R +++ + S E SS SD Sbjct: 148 EEKSCIIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHSD 204 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 24.6 bits (51), Expect = 0.65 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 185 DQRKC**NEKYRARCTYCRDWRSVQEG--RACRKDDSRNLGRFYDSGAEDISSSGSD 349 +++ C +++ R RC YCR + + G R +++ + S E SS SD Sbjct: 148 EEKSCIIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHSD 204 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 133 AALEFTGRL*VWKNWLANTSWSSSLASCDPW 41 A L F+ V+K W+ W S + D W Sbjct: 117 AVLPFSATWEVFKVWIFGDLWCSIWLAVDVW 147 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 159 DGYLVVTAPISENVDKTKNT 218 +G + + I++N+D KNT Sbjct: 408 NGSMEINQNIAQNIDHAKNT 427 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,419 Number of Sequences: 438 Number of extensions: 1806 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -